SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM35_V2.3000 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM35_V2.3000
Domain Number 1 Region: 125-161,206-367,395-506
Classification Level Classification E-value
Superfamily DNA topoisomerase IV, alpha subunit 2.09e-40
Family DNA topoisomerase IV, alpha subunit 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM35_V2.3000
Sequence length 526
Comment | organism=Leishmania_braziliensis | product=hypothetical protein, conserved | location=Lbr.chr35:1145253-1146833(-) | length=526
Sequence
MSDTPFSLSPSLPSPLSPLAICSPLCRCTWIDTTMSTAPTSYNCHRALYRQQLQRDIESL
LLLFLRDFCAEGASPTRSGYRASHLQAIAQTFYVLQIIQYSAATRREQETPYPLLQTGGD
TTHLGVCTERSLYYRNPPLFAPQGQRAAHASVKRLCDWLEVVARVPPHQQHGEGPALASL
FRSPRRLLSQLPRGTRGVASATPLYTRESLGITAAGKSLLAGALILELCDPVELIDVSAR
GSSGITLTYPLATRMVGCREASGWQAARNGISLSRPCKLVLIEKEGIHHAVLQSMMKSDT
PQTHSYVLLCTKGYPCVATRQWLRRAHALWPALQFYVMVDGDPHGLCIALTVMGLLGSKG
CPSPIASSQPKPSSSFSPPSVATTASAEAEKLKDLLPLHFLGVCPSLLWSCNFQGGLPLS
AGCLDGLASSQGIPLTTNDVQVLKRIAAAVQAVLRSAPETPDSATSLRRCDAAIVRHTLQ
RILKEVEWMQRARIKCELQLACKPLGPLTFMGQHVQRCDAELSEGS
Download sequence
Identical sequences A4HPE4
psu|LbrM35_V2.3000 gi|154345964|ref|XP_001568919.1| XP_001568919.1.15230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]