SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM35_V2.6050 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM35_V2.6050
Domain Number 1 Region: 17-67
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.000000183
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0058
Further Details:      
 
Domain Number 2 Region: 71-135
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.000000232
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM35_V2.6050
Sequence length 171
Comment | organism=Leishmania_braziliensis | product=hypothetical protein, conserved | location=Lbr.chr35:2208663-2209178(-) | length=171
Sequence
MKRFFNSLYEGTGIITDAGQRSIASRVSALAVEGVLAFTVLGTLGVDTAPLIAAAGVTGA
TIGFACKDFGANFVASIALSGQRALRTGNKVSIGVGPTMVSGTVVDWDTRYIYLQNEKKA
VLCVPNNVILNSVVTWEPPNSSVPLAAESAAPAKDNKEWSAAAGAAGPPKK
Download sequence
Identical sequences gi|154346562|ref|XP_001569218.1| psu|LbrM35_V2.6050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]