SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM35_V2.6850 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  psu|LbrM35_V2.6850
Domain Number - Region: 297-368
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00707
Family PCI domain (PINT motif) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM35_V2.6850
Sequence length 399
Comment | organism=Leishmania_braziliensis | product=hypothetical protein, conserved | location=Lbr.chr35:2525766-2526965(-) | length=399
Sequence
MSDVSSTFPWATVDAALAHGDASGAAATALEGLRASPFDRREQFFSQLSLALLPRARAPE
TASCVAEACEALWGMPEFRSNRTSASSVTGEALLLAVVLATAYTTVDKLEKAIAFDAAVL
QSSAFFTYEGLTPLERLACVARVLKASRITADPRHTDSAVQKGMSLYHGIADRARYESGD
DEVQRHRHAVVCTYLLELGLYRQERHDYLRAFQSFFALHENREDAVVLQRSALCALCVRA
SEAERQAALYSVTLRGKDAFLTPSLYHYVQVAYNGQLFSAADVEGVLATAGPYLPQSILR
SALREHNIIILAKTFECVHWRSLCVHMDDEGITEGELYDLLVSMVQAQRVSAAIYQDTGF
IEFTNTAKAHAQITDTDAFNRISAAATAIGKARPELLLV
Download sequence
Identical sequences A4HQH2
psu|LbrM35_V2.6850 gi|154346720|ref|XP_001569297.1| XP_001569297.1.15230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]