SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM09_V2.0640 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM09_V2.0640
Domain Number 1 Region: 64-114
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.00000000000494
Family Ribosomal protein L40e 0.0068
Further Details:      
 
Domain Number 2 Region: 2-35
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000226
Family Ubiquitin-related 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM09_V2.0640
Sequence length 115
Comment | organism=Leishmania_braziliensis | product=ubiquitin-fusion protein | location=Lbr.chr9:240363-240712(-) | length=115
Sequence
MKTLTGKTIALEVEPSDTIENVKAKNQDKESITPASSWRRDARSRTTTSRRSPLCTWCCA
CAAAMEPTLIALAKKYNWEKKVCGRCYACLPVRATNCRKKTCSHCSNLRMKKKLR
Download sequence
Identical sequences E9AI36
psu|LbrM09_V2.0640 XP_003722956.1.15230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]