SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM18_V2.0520 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM18_V2.0520
Domain Number 1 Region: 93-226
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.31e-33
Family Cap-Gly domain 0.0002
Further Details:      
 
Domain Number 2 Region: 1-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.29e-21
Family Ubiquitin-related 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM18_V2.0520
Sequence length 232
Comment | organism=Leishmania_braziliensis | product=tubulin-specific chaperone, putative | location=Lbr.chr18:200563-201261(-) | length=232
Sequence
MSVVKVAITHSASQRVVPEKSYGLTQTVQSIKDDMYSRFGIPAEQIRLELYDTRDCKVEG
DMKDEKLLGFYGCETGYRIHVVDLRPTAQVENYDDVSKVEKYVMTDEEWLKRPDNLRAYK
ERMLALQREEMTKAGIEVPTGPDDDSYKAEAEKMKVGDRCCCQPGERFGTVRYVGRVAAL
KPGYWVGVEFDEPVGKSNGTVKGVTLFECLPLYGGVMRPDQVKVGDFPPEEY
Download sequence
Identical sequences A4H9F4
XP_001563976.1.15230 psu|LbrM18_V2.0520 gi|154335475|ref|XP_001563976.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]