SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM22_V2.1205 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM22_V2.1205
Domain Number 1 Region: 2738-3002
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000015
Family Tropomyosin 0.00024
Further Details:      
 
Domain Number 2 Region: 2186-2304
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000174
Family Myosin rod fragments 0.0034
Further Details:      
 
Domain Number 3 Region: 2284-2401
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000802
Family Myosin rod fragments 0.003
Further Details:      
 
Domain Number 4 Region: 2535-2712
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000124
Family Tropomyosin 0.00071
Further Details:      
 
Domain Number 5 Region: 2012-2122
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000222
Family Myosin rod fragments 0.0047
Further Details:      
 
Domain Number 6 Region: 1194-1309
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000301
Family Myosin rod fragments 0.0046
Further Details:      
 
Domain Number 7 Region: 1472-1577
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000634
Family Myosin rod fragments 0.011
Further Details:      
 
Weak hits

Sequence:  psu|LbrM22_V2.1205
Domain Number - Region: 3099-3146
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00144
Family Myosin rod fragments 0.0085
Further Details:      
 
Domain Number - Region: 1679-1780
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.012
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number - Region: 2381-2445
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.017
Family Myosin rod fragments 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM22_V2.1205
Sequence length 3169
Comment | organism=Leishmania_braziliensis | product=hypothetical protein, unknown function | location=Lbr.chr22:498227-507737(-) | length=3169
Sequence
MLYAASPTPVRRPRIAESRLTPTVAPSCGGPPGDSLGRPAPREVGSSFEPHKKAHRSLPR
RCVSPDLSTRDVLTAVHDRLEHTAKFIYPGSVVVYEFLNEAHEWHWALGTVQQSHAHTVT
LEGWSCQQGCANDGVMQAMRKEENRLQQELEDHQTAILALRAELGSVRTVNEADMNAARE
AIEGCRRALEEREGTLHACRQQGVPLRLAHSDAYGGADKSGSDDDATFVAVLRAALSVVE
HYVPATPLPWPEVWAAVSDPLFLHRCISYDVGYDMSLQQYDEIEACFFGSGAITEEKVHR
AMDSMEQRMTDAAEFLCAIANWLFTQLAAFKVYQQCASTQSHADMLQQQLTHHVNTLKAA
ARRLHQVQAQLRVFGGSPGNSSSSTSSAVQLTFTPAKGITTDVLRCAIICPVPSHSRRHP
GPRVTAAQSVVASGESHSPSSSSKSAMMLANTASSSWHPSWSPDMVGDHNRIGSATDPAG
SARSPGNPKEGVQPSPCPHLASVIPAPNEEIGVVLLGQEELDEIAARALHTRPELCQAVA
DLLQECANHQRDAHRAHALVSERANRRRGRSGASKSQGDGCPPASACAAAPFASPTFLSA
AAFTDSSSSPTPPTSNGRAVAAAHNTPSVLSGPRSKAAASQSDEDEEYDEEADACAFQAA
LLGLQKKLQEVRRENERLQRMLVRETDRHKSVEAELQRQLRDARAGHEDAQSRLASATIR
AEALRVECESLDRDKDNATSRIIALEGEIRALESKHCSGRSAAPTSLPATQIKGDQGSVK
ADNGVAQREAEPAWLCRNNERWMPQHLQPSDDTDGVSTTHHHKRFSGAGWYDVLRQHPAE
LHRAAAADAAAVCHVVVAAVTGVRFSADGSRVEFYVDHPSHVTKRQLDNRIRDTTFYECE
YMRRHSFSPKTGEDLLAQQLAESIATIANLENRLAHLPPTTPPLRPSLTPSSRQEDILNE
QEQLLRAEEAPEPPLYGERLTKSRTGAVVVTLHSVRLPGDDWGVVLQSYPEMLREAFIAD
VCGACNATLTDVKHVRFSIGSLLATVRVQHDANVTRKEIDRRLHDYDYPLTTKLYRSRHL
PQHGADAALVTHTIQNNETTALREQLREAEAQQADMAAEIEHLREELRGAVTEGATNRDR
CVALEKEAEQSSKCIEELRQQLAAAQLGREAVDAEVAELEEQLRDMERTHARNAAEQESA
LGDLAISQAANDATIDDLRGQLRESEAQQADMAAEVTDLREQLREAEERAKESEAQQADM
AAEVTDLRGQLREAEEHAKESEAQQADMAAEVTDLRGQLREAEAQQADMAVDIEHLREEL
RGAVTEGATNRDRCVALEKEAEQSSKCIEELRQQLAAAQLGREAVDAEVAELEEQLRDME
RTHARNAAEQESALGDLAISQAANDATIDDLREQLRQAEAQQADMVAEVTDLRGQLRESE
AQQADMAAEVTDLREQLRESEAQQADLVAEVTDLRGQLRDSEAQQADMAAEVTDLREQLR
DSEAQQADMAAEVTDLRGQLREAEAQQADMAAEVTDLREQLRDSEAQQADMAAEVTDLRG
QLREAEAQQADMAVDIEHLREELRGAVTEGATNSDRCVALEKEAEQSSKCIEELRQQLAA
AQLGREAVDAEVAELEEQLRDMERTHARNAAEQESALGDLAISQAANDATIDDLREQLRQ
AEAQQADMVAEVTDLRGQLRESEAQQADMAAEVTDLREQLRESEAQQADLVAEVTDLRGQ
LRDSEAQQADMAAEVTDLREQLRDSEAQQADMAAEVTDLRGQLREAEAQQADMAAEVTDL
REQLRESEAQQADMAAEVTDLREQLRESEAQQADMAAEVTDLREQLRESEAQRADVAAEV
TDLRGQLREAEAQQADMAVDIEHLREELRGAVTEGATNRDRCVALEKEAEQSSKCIEELR
QQLAAAQLGREAVDAEVAELEEQLRDMERTHARNAAEQESALGDLAISQAANDATIDDLR
GQLREAEAQQADMAAEVTDLREQLRDSEAQQADMAAEVTDLREQLRDSEAQQADMAAEVT
DLRGQLREAEAQQADMAAEVTDLREQLRDSEAQQADMAAEVTDLRGQLREAEERAKESEA
QQADMAAEVTDLREQLREAEAQQADVAAEVTDLREQLREAEAQQADMAAEVTDLRGQLRE
AEAQPADMAAEVTDLREQLREAEAQQADMAAEVTDLREQLRDSEAQQADMAAEVTDLREQ
LREAEAQQADMAAEVTDLRGQLREAEEHAKESEAQQADMAAEVTDLREQLREAEEHANES
EAQQADMAAEVTDLREQLREAEAQQADMAAEVTDLREQLREAEAQQADMAAEVTDLRGQL
REAEEHAKESEAQQADMAAEVTDLREQLREAEEHAKESEAQQADMAAEVTDLREQLREAE
EHAKESEAQQADMAAEVTDLRGQLREAEAQQADMAVDIEHLREELRGAVTEGATNSDRCV
ALEKEAEQSSKCIEELRQQLAAAQLGREAVDAEVAELEEQLRDMERTHARNAAEQESALG
DLAISKLRMMPQXDLREQLREAEERAKESEAQQADMAAEVTDLRGQLREAEEHAKESEAQ
QADMAAEVTDLREQLREAEERAKESEAQQADMAAEVTDLRGQLREAEERAKESEAQQADM
AAEVTDLRGQLREAEERAKESEAQQADMAAEVTDLREQLREAEERAKESEAQQADMAAEV
TDLRGQLREAEEHAKESEAQQADMAAEVTDLRGQLREAEERAKESEAQQADMAAEVTDLR
GQLREAEERAKESEAQQADMAAEVTDLRGQLREAEERAKESEAQQADMAAEVTDLRGQLR
EAEEHAKESEAQQADMAAEVTDLRGQLREAEERANESEAQQADMAAEVTDLRGQLRESEA
QQADMAAEVTDLRGQLREAEERAKESEAQQADMAAEVTDLRGQLREAEEHAKESEAQQAD
MAAEVTDLRGQLREAEERAKESEAQQADMAAEVTDLRGQLREAETQQADMSAEIEHLREE
LRGAVTEGATNSDRCVALEKEAEQSSKCIEELRQQLAEAQLGREAVDAEVAELEEQLRDM
ERTHAEMLPSRSALGDLAISQAANDATIDDLRGQLREAEAQQADMAAEVTDLREQLREAE
ERAKESEAQQADMAAEVTDLREQLRELEEEVSKVRGMSEGVSEESVRVE
Download sequence
Identical sequences psu|LbrM22_V2.1205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]