SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM31_V2.0140 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM31_V2.0140
Domain Number 1 Region: 147-486
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.14e-69
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000771
Further Details:      
 
Domain Number 2 Region: 45-122
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.22e-18
Family Ubiquitin-related 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM31_V2.0140
Sequence length 499
Comment | organism=Leishmania_braziliensis | product=ubiquitin hydrolase, putative,cysteine peptidase, Clan CA, family C19, putative | location=Lbr.chr31:37775-39274(-) | length=499
Sequence
MQRRTATHRSSSSPPHRSPAYPSSHHPLSQSFHHRLLTLSLMLAEIKVKWGKEDLTMEVD
LGSTVGALKEALKAKTGVPVEKQKLMGLKPATSKDDATLSAAGLAPGKTVMLIGSAESAV
AVPTVQAAAGEANKTGGFTETTTTSNGLRNIANTCYLNSALQMLRTIPEIREVLEAYRGD
NALLRQLSAVLQSLESTKEAVMPLQLWTTLVQTNPTFGERDEHGGFMQQDSQEVLNVLLQ
AVNSVLPEKYAHLFEGKMHQTLTCVDDPTDKGKESEVPFTMLSCNITGEVQTLEAGLEHA
FDERFTAPCEALQKDAAQFTRVSKLSEAPEYVFVHLVRFSWRVDIQKKAKILKPITFPFI
LDTAIVSTEALKASEKPVREILQERRDKELERRRRPRAERESSPADTPEQEKVPLILKNE
SGYYELCGVISHKGRSADGGHYVYWGRKADAWLVYDDENVAAVSKEDVRRLRGAGEAHIA
YVLLYRSRCPLTRAPVIPL
Download sequence
Identical sequences A4HIX8
gi|154342134|ref|XP_001567015.1| XP_001567015.1.15230 psu|LbrM31_V2.0140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]