SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM31_V2.2290 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM31_V2.2290
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.6e-33
Family Ubiquitin-related 0.0000315
Further Details:      
 
Domain Number 2 Region: 76-127
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.00000000000000143
Family Ribosomal protein L40e 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM31_V2.2290
Sequence length 128
Comment | organism=Leishmania_braziliensis | product=ubiquitin-fusion protein | location=Lbr.chr31:1056301-1056687(-) | length=128
Sequence
MQIFVKTLTGKTIALEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLSDYN
IQKESTLHLVLRLRGGLMEPTLIALAKKYNWEKKVCRRCYARLPVRATNCRKKACGHCSN
LRMKKKLR
Download sequence
Identical sequences A0A088RX95 A0A1E1J2Z4 A4HJH0
XP_001567207.1.15230 XP_001567209.1.15230 XP_001567222.1.15230 XP_010701568.1.42505 gi|154342518|ref|XP_001567207.1| gi|154342522|ref|XP_001567209.1| gi|154342548|ref|XP_001567222.1| psu|LbrM31_V2.2110 psu|LbrM31_V2.2130 psu|LbrM31_V2.2290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]