SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM35_V2.0720 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM35_V2.0720
Domain Number 1 Region: 95-149
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.0000000000000033
Family Ribosomal protein S27a 0.0072
Further Details:      
 
Domain Number 2 Region: 1-78
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000875
Family Ubiquitin-related 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM35_V2.0720
Sequence length 152
Comment | organism=Leishmania_braziliensis | product=ubiquitin/ribosomal protein S27a, putative | location=Lbr.chr35:203036-203494(+) | length=152
Sequence
MQIFIKNAAGRTVAVRVSAEDTVASLKVQANVTVGNLFFAGMCLAEEETLAAYGLSQEST
VDVVIPVEGGKGKKKKKRIFTKPKKPTHRHKLEKMRALKYFKVTENDDGSYKVERMRQDC
PHPQCGAGVYMAQHKDRQYCGKCHLTYRAESK
Download sequence
Identical sequences A4HNS0
XP_001568695.1.15230 gi|154345516|ref|XP_001568695.1| psu|LbrM35_V2.0720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]