SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|99080772|ref|YP_612926.1| from Ruegeria sp. TM1040

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|99080772|ref|YP_612926.1|
Domain Number 1 Region: 139-422
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.4e-125
Family Enolase 0.0000000176
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.65e-58
Family Enolase N-terminal domain-like 0.00000293
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|99080772|ref|YP_612926.1|
Sequence length 425
Comment phosphopyruvate hydratase [Ruegeria sp. TM1040]
Sequence
MSTIIDIHAREILDSRGNPTVEVDVVLEDGTMGRAAVPSGASTGAYEAVEKRDGDKSRYM
GKGVLEAVAAVNGEIADELVGFDATEQVSIDRAMIELDGTENKGRLGANAILGVSMAVAK
AAADFTTQPLYRYVGGAAARILPVPMMNIINGGEHADNPIDIQEFMIMPVAAENIRDAVR
MGSEVFHTLKKELSAAGLSTGIGDEGGFAPNIASSREALDFILKSIEKAGYKPGEEIYLA
LDCAATEYYKDGKYVLSGEGKTLTSEENAAYLAALVNDYPIISIEDGMSEDDWDGWKALT
DQIGDKVQLVGDDLFVTNPVRLAEGIERGCANSMLVKVNQIGSLTETLQAVDMAHRARYT
NVMSHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEETLGEIAEYAGR
SILKG
Download sequence
Identical sequences Q1GI52
gi|99080772|ref|YP_612926.1| 292414.TM1040_0931 WP_011538274.1.15988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]