SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|99080869|ref|YP_613023.1| from Ruegeria sp. TM1040

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|99080869|ref|YP_613023.1|
Domain Number 1 Region: 24-234
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.96e-52
Family Methylesterase CheB, C-terminal domain 0.00013
Further Details:      
 
Domain Number 2 Region: 318-513
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 5.71e-43
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.0025
Further Details:      
 
Domain Number 3 Region: 1078-1240
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.64e-33
Family Histidine kinase 0.0013
Further Details:      
 
Domain Number 4 Region: 894-1008
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.24e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.035
Further Details:      
 
Domain Number 5 Region: 1008-1087
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000000124
Family Homodimeric domain of signal transducing histidine kinase 0.0052
Further Details:      
 
Domain Number 6 Region: 246-320
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.000000000000144
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0035
Further Details:      
 
Domain Number 7 Region: 755-874
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000274
Family BphP N-terminal domain-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|99080869|ref|YP_613023.1|
Sequence length 1248
Comment signal transduction histidine kinase with CheB and CheR activity [Ruegeria sp. TM1040]
Sequence
MTENNISPLHPAQTGAHRKIGKVDERFYIVGVGASAGGLDAIKQLLARVPVDFAHSFVVV
QHLSPDYKSVMTEILGRETQHKVVEVSDNMRVEPKHIYVIPPGANIVIQGTEDDLDDRVI
GSSAAPSASKPVHEGLRFSLLAPQPRPALNLPIDIFFRSLAEAVGKRAIGVILSGTGSDG
SRGLRSIKDREGLVIAQEPATCGFDGMPQQAIATGLVDQVLQPDDIVGEISRFIDLRDRG
ISDVDEIFDGAQDSFRAILETVSKQAEIDFALYKEPTLQRRIARRMGFLGLSNLEDYLSY
LGENSGEVQLLYREFLVGVTNFFRDLPVWQAMETRVLERLFAEGDTDQPLRVWSAGCSTG
EEAYTLAMLLQKFRDDNQIERDFRIYATDVNENAINTAKQGIYPDHTLEEIPEAYRNAGY
ITHHPGTFAISPTIRSQIVFAVHDITLDPPYTRTDLIVCRNLLIYLGPDVQAKVMVNFSM
SLRINGYLLLGAAETPGSDGVRFEYFMGKERIFRNKRVARAGSGRAKLATQMPALGMLPR
TRRMMSSGLSIQDDLSALFQFSLEAGQMSICVLDQGSNILKTFGNMQTLLHIPEGGFSTN
IFDLCDDRLRSSIALVVRGVEDQTTAQASDMRLIEGDSVRTVSVSARKIIWEGHASAVAL
FVRQITQTLPKAAAENSDEEPQIERSAYIEHLESEVRSLQEMLGVTAQDLGASNEELQAA
NEELIAANEELQANNEETQSINEELHTVNSENIDRIAELEEVNADVDNLLETAALGILLL
DTDMCIRRFSAGVTRYLDLKHSDLGRPLESFATALLPEAVTLLVDDARLARDQGEETQRE
LRRRDGGFVQTRVRRFNRQRGDSHGVVITLLDITDTKLLEQEARRQSEILSSVLESEESG
YWDWNIPEDKLYISRRFVEFLGFGVGELAPNSSAWQGLIHSDDRPQFHEAYRAHVNARGE
VPFLIEARYLTKEGEEVWIRSRGQVTDWGQDHRPLRMIGVHQNISDLRAREDDIEKRADD
MRRFAYVLAHDLKQPLNTIEGSVQALDEELPKTLDADIHELMRFLQQGTQRLKARVNAVL
DYARLQDQTTRFEPCDLAQIIDACLVDLEDTVAQANAEIVVEPLPAVSGTPELLVRLMRN
LLSNALKFRDPARPLKITIAAINAPYGRVGLRVDDTGIGIAPQDRARVFELFSRLHVESE
IEGSGLGLAMCDQIVSIHGGQLEVVEAETGGASFRFTLPAAPAAPDGA
Download sequence
Identical sequences Q1GHV5
WP_011538371.1.15988 gi|99080869|ref|YP_613023.1| 292414.TM1040_1028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]