SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|311112593|ref|YP_003983815.1| from Rothia dentocariosa ATCC 17931

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311112593|ref|YP_003983815.1|
Domain Number 1 Region: 58-148
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 2.75e-22
Family Ribosomal protein L9 C-domain 0.00071
Further Details:      
 
Domain Number 2 Region: 3-57
Classification Level Classification E-value
Superfamily L9 N-domain-like 3.31e-16
Family Ribosomal protein L9 N-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|311112593|ref|YP_003983815.1|
Sequence length 150
Comment 50S ribosomal protein L9 [Rothia dentocariosa ATCC 17931]
Sequence
MAKIILTQEVTGLGAAGDIVTVKNGYARNYLLPRGFAVSWTVGGEKQVESIRAARAARAK
ASLEEAQETAAKLSARPIVVAHKAGADGRLFGSVKADAIADAIEEAGLGTIDKRTIHLGS
AIKRTGEYQVTARLHEDVVANVTLDVVAAA
Download sequence
Identical sequences A0A1F0T918 A0A1F1IZK5 A0A1F1QTJ5 A0A269YJD4 D8UNT8 E3H342
WP_004005949.1.16177 WP_004005949.1.30039 WP_004005949.1.33959 WP_004005949.1.341 WP_004005949.1.35488 WP_004005949.1.43111 WP_004005949.1.68239 WP_004005949.1.70305 WP_004005949.1.7184 WP_004005949.1.79762 WP_004005949.1.84200 WP_004005949.1.90408 WP_004005949.1.91874 WP_004005949.1.9310 WP_004005949.1.94899 gi|311112593|ref|YP_003983815.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]