SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|311113016|ref|YP_003984238.1| from Rothia dentocariosa ATCC 17931

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311113016|ref|YP_003984238.1|
Domain Number 1 Region: 1-179
Classification Level Classification E-value
Superfamily Formyltransferase 9.16e-56
Family Formyltransferase 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|311113016|ref|YP_003984238.1|
Sequence length 187
Comment phosphoribosylglycinamide formyltransferase [Rothia dentocariosa ATCC 17931]
Sequence
MVSGSGTNLQAILDAVKADELNAEIAAVGADKPCTGLDRAAAAGVETFLIEPTDYADRDQ
WNRALEEKIASYTPDYVVFAGFMRIVDAQLVARFENRIINTHPALLPSFPGAHGVRDALA
HGVKITGLTVHFVDSGVDTGTIIAQAAVPVEDGDTEESLHERIKVQERQLLVRILAEFAA
LPKTQNP
Download sequence
Identical sequences E3H5H1
gi|311113016|ref|YP_003984238.1| WP_013398549.1.30039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]