SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|311112675|ref|YP_003983897.1| from Rothia dentocariosa ATCC 17931

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311112675|ref|YP_003983897.1|
Domain Number 1 Region: 76-392
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00000000000383
Family L-arabinose binding protein-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|311112675|ref|YP_003983897.1|
Sequence length 451
Comment hypothetical protein HMPREF0733_11006 [Rothia dentocariosa ATCC 17931]
Sequence
MTPEPQLEEEQTSRRVPLTIIGWGALLGVLLLVIVVAAHLLRPDIRPLRAPGDTEAIAPV
VPQEITLPNNNNRDAKIGIIMTYGEDAEGSEWVLPAQGAAVAAHRLDLGKTPVQLTVAND
KGTSDGARDAVEKLKSEGVQGIIISSSGEHIKGATSAARESSIPVIEVYDSVDTGRGVWS
LAPNPEQLSQAYVQASQPSTQSIVIAPKDTEVKIPQVATKHAYDRDTDVRELAQDVKKES
QSYGASANIFVSGSAIRQAKIVKELQYAGVTAQILLSPQAVSPIFARTLVAEGGTVSANL
TTVGYNMSDSLALQSDDPGRGLAAFLEAVRVMGQDSSYMTLQDDQAFKSAAPYADARSHN
AVLAFAYAIDKVHERKPEAVTRVLESMRLDAAQAIAGDALDFTHENPTTAPVQTLHATEQ
SLGLRPEPSNDQEPRIVWFAERGTRTETYNE
Download sequence
Identical sequences E3H3K1
WP_013398239.1.30039 gi|311112675|ref|YP_003983897.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]