SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPIJ006744|copper from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ006744|copper
Domain Number 1 Region: 8-185
Classification Level Classification E-value
Superfamily CutC-like 3.27e-44
Family CutC-like 0.0000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ006744|copper
Sequence length 237
Comment homeostasis protein cutC|protein_coding|supercont3.156|611811|612609
Sequence
MTTTTPTLLEICIDSYDSAVAAIRGGANRLELCAALSEGGLTPTVGLLREVRKLIDDVRP
VHLYAMIRCRRGSDFCFSDPELAIMVTDLRLLAEHGADGFVFGALTEQAEIHREHCRLIA
EEALRLGKPVTFHRAFDCTAVDTMGENLRLVGSLGFTTILTSGFESTAVRGLENIQRLAE
LAKDLEFLRLMQGIFFSRPDAGLFMRRPDRLPRKGEQAVCLWEVAQRMEKVCSCVMR
Download sequence
Identical sequences B0WK85
CPIJ006744|copper XP_001849119.1.94360 7176.CPIJ006744-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]