SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ015136|dodo|protein_coding|supercont3.608|262958|263505 from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ015136|dodo|protein_coding|supercont3.608|262958|263505
Domain Number 1 Region: 48-158
Classification Level Classification E-value
Superfamily FKBP-like 8.5e-32
Family FKBP immunophilin/proline isomerase 0.0000122
Further Details:      
 
Domain Number 2 Region: 5-42
Classification Level Classification E-value
Superfamily WW domain 0.000000000178
Family WW domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPIJ015136|dodo|protein_coding|supercont3.608|262958|263505
Sequence length 159
Sequence
MSDGQENVPEGWEKRTSRSTGMTYYLNVYTKESQWDPPTKPASPGDTTSEVQCAHLLVKH
RDSRRPGSWREENITRSKSEALLILEGYRKQIQSGEATLPELAQKYSDCSSAKRGGDLGM
FKRGMMQKPFEDAAFALKVGDMSDVVDTDSGVHLILRLK
Download sequence
Identical sequences B0X6Q0
XP_001865322.1.94360 7176.CPIJ015136-PA CPIJ015136|dodo|protein_coding|supercont3.608|262958|263505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]