SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPIJ020249|copper from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ020249|copper
Domain Number 1 Region: 8-184
Classification Level Classification E-value
Superfamily CutC-like 3.14e-44
Family CutC-like 0.0000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPIJ020249|copper
Sequence length 245
Comment homeostasis protein cutC|protein_coding|supercont3.2593|9737|10535
Sequence
MTTTTPTLLEICIDSYDSAVAAIRGGANRLELCAALSEGGLTPTVGLLREVRKLADAARP
VQLYAMIRCRRGSDFCFSDPELAIMVADLRLLAEHGADGFVFGALTEQAEIHREHCRLIA
EEALRLGKPVTFHRAFDCTAVDTMGENLRLVGSLGFTTILTSGFESTAVRGLENIQRLAE
LAKRLRSPSCQDLEFLRLMQGIFFSRPDAGLFMRRPDRLPREGEQAVCPWEVAQRMEKVC
SCVMR
Download sequence
Identical sequences B0XLC0
CPIJ020249|copper XP_001870442.1.94360 7176.CPIJ020249-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]