SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPIJ001714|rootletin|protein_coding|supercont3.19|1463366|1471246 from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ001714|rootletin|protein_coding|supercont3.19|1463366|1471246
Domain Number 1 Region: 1422-1610
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000124
Family Tropomyosin 0.0027
Further Details:      
 
Domain Number 2 Region: 1642-1768
Classification Level Classification E-value
Superfamily Tropomyosin 0.000034
Family Tropomyosin 0.005
Further Details:      
 
Weak hits

Sequence:  CPIJ001714|rootletin|protein_coding|supercont3.19|1463366|1471246
Domain Number - Region: 443-547
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000225
Family Myosin rod fragments 0.0097
Further Details:      
 
Domain Number - Region: 1157-1333
Classification Level Classification E-value
Superfamily Tropomyosin 0.0602
Family Tropomyosin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPIJ001714|rootletin|protein_coding|supercont3.19|1463366|1471246
Sequence length 1973
Sequence
MSSPSTSPTTTDTGVLIRQNNELRHRLQQEASTYRRRLETYKQAEGNQAALISRLQAKVL
QYKQRCTELQETPPSSTCYNAGGGPARDVSPGHHHAGTPAPCSGTSGGPLSLPPCPVARE
RSRSRSRSQSPCRKYADCGHDEVRHQLDEERRRCEKLMVENSCLRQQLEESQRTNDALTN
DLQKLTCDWEALRDELLSKEDEWKEEEQAFNEYYNNEHTRLLKMWREVVNVKRMFKEMAS
TTKMELGRMHLELSGTGREVTGACSGVSVNLRQSTKIEEAQQMHIERENIDLKSQMGDLR
MQYENAKLEIAQRDQRLQQVLQDLKQMEERYVQADSQAGQTQRLNDELERLQGALRDIAH
AVVQDSETAATSEAEPSSAHHLHLSQSSGLPAPPRSPKRGAIRTSQAFAEGTISAVQAAL
HKYQLAIHDLQVKLQTNSDALAATRKQYDNCEHTRDVLTGKVTELTEKLDTANHQLSELY
KERDSLQKTLDSLRTDKHSVERGKAELNSIVDSLNTDYEKLQNVNCKLQKMYDSLEEEKK
MLEGELQRVQKDKDIQEMNLRAEEERSSRLREETITLREELNKLYLARDLLEQQRIESDG
LLNMIEKQKIELEFELDRIVNEREGLQMTLEKKSSSNDHLEVEIKQLKASVATLEEERSR
LKTQVSDQGTDLAALKKELIATEQARLDLDSEKLAISERLKCLEMEKDKIEQELSCVARE
RNDLSNQTAVISRKKETIGEEVMRLRQRLEQANEMNARLNRNLEELVKESEEKAVVIEGH
EKELQRLQEQQASLRSEKESLEAVLFDTNTSLEEAEARKDALERENQDLLIKQESNKALI
CRLNKDLENSERRAQDIKIQLTNAAANQEAEFLQKLSSIRTFGEENIKKLNEEKEAIRSS
LEKRMHQALQALENAKDTEIASLKEQFEALQMHLEALNQQHEEVVLRAENEKQQSLLIAH
RDKQAVIEKLDHVTRELKNELDNSDRLKREMAARQEKDRTTIGCLRDEVGKMRTKMEEAR
IRAEEELNRLEVLQGALRDEKDLALREIEELKVQLRLSEDRCDGLNQQVQDHLRKLKEAD
NCIDGTRKELTDTRRTLADSNIERDKYSTSNKELRDHVKRVEGQRREQARAMDDALQKIA
GLEESRNLLEQEKVRLQTILKETENNVTKMTQDLSTAQADITKFQSQTTQNDAAEKELQA
RLTNETEEKERILQELHQIKKQMSDLEGTLCSTRQDLGRARCKANQDEHRFHQREQELCT
RIEEGRGREKRLEDQKHNLEVCLADATQQIQELKARLGGSEGRVRALDEQLMHLDGIKKE
VENKLSSIGHTLRRIAGIQMDGSVSLPYRLLSPSRRYSPARGREREDFHHHHHHHQQQQQ
QHDTRSLSGDNAIIDVDPEMVRKGVRTLMQQVAQIERERDDFKMQLCTAKKQLHEGGDNA
MRLETKICKLQQHNRAIHEDKTNLEAKLAQRTSALQSTEETLKQKSDELNITREKANHLE
QSLGNTTEEKAQLEERLEKCRQNVCRLESDKRHLQDELSRIEGRASKLDLQRVALEGDIQ
RLQMALQEKDCTIRNVQERLENLQRSSTQLEDRCAALKSTVDQLKERLQAAAITETELRG
EIAGLHRHNSDQGHTFALGQDKLKQLQKNLTNSENERRVLSERLDAAQHSINELRRNHQS
SQDQTQRLQEHLAECEVQKSALESQLRLAKWNQENAEQFGGGAGGDQDLARQLVNSQRDR
TELRNKLEAMNEKVRHLENEKRGIEKSSKFSGHVQFDRSEKTDLGELDSNRLESSGSKFN
CGLDHAQIEQESRELRMKVRRMETLLAEKEAELARAKAKMLESPLKSTAGSSTGGDVERY
RSAQVQAERLLDAREQSHRQQVVRLENQISMLREQLAQEAKRRQMYILKSSRAGREMQQL
RQTLGDSLRHVAQDPIDSSLLQNEARRLDSAVSLSLPPTTSRDYDRSLSPTYR
Download sequence
Identical sequences B0W3H0
CPIJ001714|rootletin|protein_coding|supercont3.19|1463366|1471246 XP_001843254.1.94360 7176.CPIJ001714-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]