SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPIJ001768|S-phase from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ001768|S-phase
Domain Number 1 Region: 87-162
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.66e-32
Family Skp1 dimerisation domain-like 0.0000154
Further Details:      
 
Domain Number 2 Region: 3-71
Classification Level Classification E-value
Superfamily POZ domain 3.66e-20
Family BTB/POZ domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPIJ001768|S-phase
Sequence length 165
Comment kinase-associated protein 1A|protein_coding|supercont3.22|165342|165839
Sequence
MPIIKMQSSDGEVFDTELQVAKCSGTIKTMLEDLGIEGGDGEEDVIPLPNVNSAILRKVL
QWANYHKDDPVPATDEDETKEKRTDDISSWDADFLKVDQGTLFEIILAANYLDIKGLLDV
SCKTVANMIKGKNPEEIRKTFNIKNDFTPAEEEQIRKENEWCEEK
Download sequence
Identical sequences B0W408
CPIJ001768|S-phase XP_001843442.1.94360 7176.CPIJ001768-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]