SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPIJ005092|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ005092|conserved
Domain Number 1 Region: 843-1038
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000492
Family Fibronectin type III 0.0054
Further Details:      
 
Domain Number 2 Region: 282-324
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000377
Family Fibronectin type I module 0.049
Further Details:      
 
Domain Number 3 Region: 708-800
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000273
Family Fibronectin type III 0.0074
Further Details:      
 
Weak hits

Sequence:  CPIJ005092|conserved
Domain Number - Region: 170-234
Classification Level Classification E-value
Superfamily FnI-like domain 0.0136
Family VWC domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ005092|conserved
Sequence length 1128
Comment hypothetical protein|protein_coding|supercont3.90|48978|78729
Sequence
MSQLLISTPKQSRTVCTSSATLPPPPGNNSTNVTRHPPSSRTGTRPRLPCPPGFSTSRVR
KACCASTRSAQPAQIRTVGSTSGEICKGRTIRNEAKDRRITHPKSEAVDGLVGNSWVGAQ
IRTGLLAQIAGKVVARIGSTNPSTDDTSADHHSTAGPTTTSTSTTAIVVTSCIHRNQSYP
VGAKVEMGCEKICTCNAEGELDCAARCPPINETRSEHCVTLPDPNDACCHREFCDVILDD
HEQNGMMMMMAPATASSSPSKVLVDGAPSGSSSTEKNDFSGEIDQCEFRGKMYTKNQQFH
DDCNALCLCTDAGVHCAKIECPSHFGLDVLDPHCLRWEPEPATFRAIAPRCCPERMRCVD
NGTCEFKGQSFENWSEIPSNLTGCDQHCYCESGNVECRPACPPVPKNPPPSLPCSPRMAR
LAPLPDDDCCKHWTCSGGGGEPAITGNDVLKPLLMPPDTITQFLPTKSPKSEKGEKAPPK
PDRESPEEGPQQHLPFYPTVDGKPPPKVPQEKPHKKYPKDDSKKDHYNNIYPGGSGVGGG
IVDQHGPPPPPPPTSFGTGYGDAPKPATLGVQRPGPPGYYGPDLKPSYPNDYNPYVHVSG
PPGSVPLPPGGQLPVHPLDKQLLNALGGGNPQNIPPNIRIEQLLQQIHAQDPNPQGPPPP
HVLHHPGGQYPQSSQPTGVAAVGNGLNYNQYGPNLGYPSSLATDLRVLQLDAIDPNTVRV
IFIVPQVYVGLHGRVELRYTRTRNNDTSTWQAQVFAPPDDLIATSQLEFELPGLEPNTEY
RVKITLVLRDVNSQPSSQVYNVRTPSDRVITPPTLINTDLGHFPHLGHPTNFLKEIIQDP
MLQTQDVNASWARISWRKLDDEELDYVDGIQLRFKEIDGMVYDATPLIHRALSEYTLENL
KPQTRYEVGIFFIPFPGHGEEVRAGEMLQFTTAARVDMYGFEVIVNVSKVKAGSVEVSWS
GVPYPEDKYINIYRAIYQSDSGKEDSSVFKVAKRDSTTGTLIADLKPGTRYRLWLEMYLT
NGSIKKSNVVNFITKPGGPAIPGKTGKLSVAGADVPPGDYYGPLVVVAVIAALAVMSTLI
LLLILTRRRVQSATITPPRKNEVSYDNPSYKVEIQQETMSEFGSDFRV
Download sequence
Identical sequences B0WDW8
CPIJ005092|conserved 7176.CPIJ005092-PA XP_001846902.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]