SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPIJ005423|vacuolar from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ005423|vacuolar
Domain Number 1 Region: 43-200,351-545
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 6.15e-43
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.011
Further Details:      
 
Domain Number 2 Region: 686-951
Classification Level Classification E-value
Superfamily YWTD domain 1.07e-38
Family YWTD domain 0.00000464
Further Details:      
 
Domain Number 3 Region: 1431-1608
Classification Level Classification E-value
Superfamily Fibronectin type III 3e-24
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 4 Region: 1621-1786
Classification Level Classification E-value
Superfamily Fibronectin type III 6.95e-17
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 5 Region: 1231-1270
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000012
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 1092-1129
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 7 Region: 1287-1324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000106
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 8 Region: 1176-1212
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 9 Region: 1132-1173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 10 Region: 1051-1088
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 11 Region: 1010-1047
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 12 Region: 1328-1362
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000537
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 13 Region: 1378-1412
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000589
Family LDL receptor-like module 0.0026
Further Details:      
 
Weak hits

Sequence:  CPIJ005423|vacuolar
Domain Number - Region: 1817-1941
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00392
Family Fibronectin type III 0.01
Further Details:      
 
Domain Number - Region: 955-993
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0511
Family EGF-type module 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ005423|vacuolar
Sequence length 2093
Comment sorting protein|protein_coding|supercont3.88|826383|841593
Sequence
MISTLAKVNKLNDSHAQLIVHWLGEGTSVMICLAREPPADNDAVAKAPPPQPSRIFVSKD
YGDTFVDQTNMFELEVNGTKINSTVEQFFTHPKFNTIVFTDPRNKAIFTSEDYGATVKVR
MLNFTPSDVTFYEADTKMILILDKKDPERKLYYTTDFGASFTLLQSYVKSYIWSSGEGVP
IHLYVERKEPTNTSSVIFYNAANLRNNTNQFNVLIEKVEDFHIKKDFMFASQRLPNSTQL
LISYKRGKFVKADFQTELDMKGYHVADVDGRRIMISVVHTERISHLYVSESNADMSDIKF
VPSLENVFTYVPELNWRSSWLVQSSDGAFTDLYKVEGLRGIYIASKINRIPLGETISPDS
LVSLITFDHGASWRPITAPTTDDDGLPIANCVKDCSLHLSQKFSSLYPVTRSVSIMSSKS
APGVIMASGVVGKSLKGHPGVYISRDAGLTWKQILKDYHFFNMGDHGGILVAVKYFKSKG
ETNEILYSTDEGEKWRSQSFHSTNLKVYGLMTEPDTNTTIFTLFGSEQEEHKWLIIKIDL
KKAFTSNCTEDDYKFWAPGANLGDSFMPCILGQQDTYQRRKPLANCYNGIDYDRPIRQQV
CMCNSYDFECDFGFSRTTGSKNSPCVRNKTLANFDPYAVPSSCRAGQFFNRTKGYRKIEG
DVCTDGYSSQYLPQPIPCPMGEVDEFLVIAQRDKISRIILGNKTKEVFPVTGLKNVIAIE
FDMKHNCVFWADIMTDVIGRQCLDGKNSTELLVDSGLSSVEGMSYDWISEMLYFVDGMRL
KIEAVRTGSGPLKGLRRTIIDAPNLNKPRGIVVHPLQGYLFWTDWNALRPSVSRANLDGT
DIKLLFTKPDVVWPNGVTIDHIAERLYWVDASKDYIASSDLNGKNFMKILQQDSRVAHPF
AVAVMKDLMYWDDWKMNSVYSADKDHGIMINIIAEEMMNSMDLKIYGHSIQEGGNACSEG
NKCSHICVGAPKGGYSCLCPDGMEKNAQGQCLCPGGVTPFANNTCARSGSTCGSKFFACK
NAVCVPQIYKCDGDDDCGDRSDEEGCPADKPPCPPYMFTCKSDKQCVPKYFVCDYDRDCL
DGSDEQNCKAASCKSDEYTCGNGRCINKSWLCDGEDDCRDGTDEATCNKNNTATVECKPD
EFRCNGTNSCIPKQWRCDTEHDCNDGSDEQDCTKKECESWMFTCESDGRCIYKTWQCDGE
KDCKDGSDEKNCSSSTEMPKKPGINFLPGDSCHDWMFKCANDKCVPYWWKCDSVNDCGDG
SDEAGCNSTVIITSTTAKPIPTRKKERNCGLHEFRCDSGVCISKRFVCDGYEDCSKGEDE
GNCPSQKQCSNKHFKCRSDGQCLPMEKYCNGVVDCVDGSDEDCKFKPSPSTTTKNNCTNN
PGVFACDNTCFALMMLCDGKADCYDGSDEEHCEKGKVKHYQVTQIGVDERSLNSTSFVVF
WWIPLPRDVSLEYLPSIYYNGEWKNVSTWIEQTDYRFTNLKPYTVYNVTTYVRVKNQTKI
TPPYFYLEIATSEGVPSVPLNVSVVQINGSRIMVSWQPPKDVNGLLQGYTINYRSQSKNV
GPALNAKVGPSETSFIIESEFKPDMVYDFWVKARNGKHESSSSNMVQLKFDGTSNIEQIS
KIAVTNITKKSVTLEWKSVANADGYMIEPMLPQSYPQLSKLWVKNSTVTLDNMVPGTQYV
IRVAAYVKQYVGRHETTIVKFGGEPLPAINLRLKEQTQEYSLLEWDEPHGSYGKLTYGIY
YGTNMDQLFEASKINTTATSYKLTKLRPCESYLVSIGIVGPIGPGPLGRNPLKLDTPYNN
TLPPKELTVDISDSSQFNSEMIIQWKHSCSLESSAYPNYIISVRELKKNSTTLVNVKSSA
NKTLVHVFRNIPVGAVYEVAVSTDVQHAQVVTTVVYSRPLPNPTQLKVWPETNGTYVVYW
KPVLNFNETQFTYEAVVYDGRGLNTTIPPLVVIEAKEPPILIHPDRLAGVPIGHLFTIGV
RLKTTGPNGGYYSDIAQIETFEKHNFQSLVQTSSYSSAWLWLVPTLVAAALAVTVVYVVQ
RHRRLQTSFSRFANSHYDTRTGATRIGDSLDDDDHEHQEVPRSFSDDEPLVIA
Download sequence
Identical sequences B0WDS5
CPIJ005423|vacuolar 7176.CPIJ005423-PA XP_001846859.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]