SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPIJ006052|receptor from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ006052|receptor
Domain Number 1 Region: 1230-1507
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.36e-101
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000178
Further Details:      
 
Domain Number 2 Region: 845-1024
Classification Level Classification E-value
Superfamily Fibronectin type III 4.9e-26
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 3 Region: 479-637
Classification Level Classification E-value
Superfamily Fibronectin type III 9.38e-20
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 4 Region: 78-188
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000202
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 5 Region: 181-277
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000951
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 6 Region: 373-462
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000973
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 7 Region: 646-682,712-830
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000206
Family Fibronectin type III 0.0069
Further Details:      
 
Domain Number 8 Region: 276-369
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000177
Family Fibronectin type III 0.0033
Further Details:      
 
Weak hits

Sequence:  CPIJ006052|receptor
Domain Number - Region: 1035-1082,1119-1156
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000459
Family Fibronectin type III 0.01
Further Details:      
 
Domain Number - Region: 27-99
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00059
Family Fibronectin type III 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ006052|receptor
Sequence length 1689
Comment protein-tyrosine phosphatase 10d|protein_coding|supercont3.106|381739|425190
Sequence
MRLIVQVVCRSADLVIEIPGNLGADDSYYRLDYYPPVGNPTPNATIASRDVGDEIQFSNG
LPGTRYNFWLYYTNSTHHDWLTWTVSITTAPDPPSNMSVAVRSGKSATVSWSPPSQGNFS
AFKLKILGVSDNFVTNQTIAVEESQFQYSLRDLTPGATYQVQAYTVFDGKESVAYTSRNF
TTKPNTPGKFIVWFRNETTLLVLWQPPYPAGIYTHYKVSIEPPDALGSVLYVQKEGEPPG
PAQAAFKGLVPGRAYNISVQTMSEDEISLPTTAQYRTVPLRPMNVTFDRKAVTENSFKVM
WEAPKGTSEFDKYQVSIAATRRQQSVLRNDNENMAWVEFKDNPDPGKTYSVVVKTVSGKV
TSWPASGEVTLKPLPVKNLYSYTDSKTGILTISWIPDNASTQDEYKISYHELETNNGDSS
TMNTDKTTFALESLLPGRNYSITVQAISKKMESNESTIFVVTRPSSPIIEDLKSIREGLN
ISWKSDVNSRQEKFEVTYTRNDTNDGKTVLTTESRLVFTNLYPGAGYEVKVFAMSHGLRS
EPHSYFQAVYPNPPRNMTIEKVTSNSVLVHWKPPERSEFTEYSIRYRTESEKQWIRLPSV
KATEADVTDMTPGEKYTIQVNTVSYGVESPNPQQVNQTVRPNPVSNIAPLADSNNITLEW
PRPEGRVETYIIHWWPTEFPDQVSTKNVSEVNTILPYPGSGLGDEEKPAEELPTVRILVG
DLMSGVMYNFKIQTVSYGLTSDVTKLQTRTMPLIQSEVLIVNNVQMRDAVTLSYTPTPQQ
SSKFDLYRFSLGDVSISDKEKLANDTDRKVTFTGLIPGRLYNITVWTVSGDVASQPIQRQ
DRMYPDPITVLNAGNITDTEIVLNWDIPKGEYNAFEIQYLKNDSHYVQNFTVNNHITIAD
LKPHRNYTFTVVVRSGTESSVLRSSLPVSASFQTKESVPGRMDKFAPVDIQPSEITFEWS
LPPNEQNGVIRQFTITYGLDGSQHTQAKDFKPTELRGIIKGLLPGKTYIFRIQAKTAIGY
GPEQMWKQKMPILAPPKPETQVVPTEVGSSATTIEIRFRKHYFSDQNGVVTTYTIIIAED
DSKNASGLEMPSWYDVQSYSVWPPYQVIEPYYPFKNSSVEDFIIGTENCDTRKSGYCNGP
LKSGTTYKVKVRAFTAPDKFTDTAYSYPIRTAQDNTSLIVSITVPLFIILLLVGTIVFLR
RRRHTGRKKATEQRANDNMSLPDSTMETSRPVLVKNFAEHYRMMSADSDFRFSEEFEELK
HVGRDQPCTFADLPCNRPKNRFTNILPYDHSRFKLQPVDDEEGSDYINANYVPGHNSPRE
FIVTQGPLHSTRDDFWRMCWESNSRAIVMLTRTFEKGREKCDHYWPHDTVPVYYGDIKVT
LLNDSHYPDWVITEFMMTRGDTQRILRHFHFTTWPDFGVPNPPQTLARFVRAFRERVGPD
QRPIAVHCSAGVGRSGTFITLDRILQQIQVSDYVDIFGIVWAMRKERVWMVQTEQQYICI
HQCLLVVLEGKEGTEREIHDNPGYEEPGEQEEASEERQLIDGQEVEAIGDQLVEAASASD
MIDDNEEEQHNEGEAEQQEDAQIAQSNTLSNSSRTDDAKDNNTNHCQETEVIAVEVQAYT
RSNSREAAAAEESAENSNETSREDSGSSSSGGQLIESVEPKSEGINNSEQQQQQQQQQSI
GNKLWKEER
Download sequence
Identical sequences B0WFI2
CPIJ006052|receptor XP_001847466.1.94360 7176.CPIJ006052-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]