SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPIJ006669|sidekick|protein_coding|supercont3.127|111607|130832 from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ006669|sidekick|protein_coding|supercont3.127|111607|130832
Domain Number 1 Region: 414-603
Classification Level Classification E-value
Superfamily Fibronectin type III 8.78e-35
Family Fibronectin type III 0.0000802
Further Details:      
 
Domain Number 2 Region: 609-816
Classification Level Classification E-value
Superfamily Fibronectin type III 8.51e-34
Family Fibronectin type III 0.0003
Further Details:      
 
Domain Number 3 Region: 923-1108
Classification Level Classification E-value
Superfamily Fibronectin type III 5.65e-33
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 4 Region: 215-410
Classification Level Classification E-value
Superfamily Fibronectin type III 6.11e-31
Family Fibronectin type III 0.00037
Further Details:      
 
Domain Number 5 Region: 26-170
Classification Level Classification E-value
Superfamily Fibronectin type III 7.12e-26
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 6 Region: 807-927
Classification Level Classification E-value
Superfamily Fibronectin type III 2.77e-20
Family Fibronectin type III 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPIJ006669|sidekick|protein_coding|supercont3.127|111607|130832
Sequence length 1363
Sequence
MDSQRLSTNPTSNHRFFPPRSVAPSGPPVGFVGSARSSSEIITQWQPPLEEHRNGQILGY
IIRYRLFGYNASPWNARNITNEAQRNYLIQELITWKDYIVQIAAYNNMGVGVYTEGAKIK
TKEGVPEAPPTNVRVQALNSTAIRVWWKPPNPQQINGINQGYKIQAWKYEIYDGEEHEME
AKTVTVPPSLLDPLAEQDTVMAGLDKFESYNITLALSNIEAFSVVIQFTPGFDGNSSITK
WTVEGQTARNLTWFTVYEVHDPDAFTLTVTGLTPFTPYRLRIIAWNVVGPSEPSEPTKDF
QTIQARPMHPPLNVTVRAMSATELRVRWIPLQQTEWFGNPRGYNITYRNVNEKSQVAPYS
VVIEDPTANSHVLDNLEEWSVYEIFMRSVNEVGQSADSPHAFERTREAVPSFGPLGVEAN
ATSSTTIVVKWNEVPKEHRNGQIDGYKVFYGSAGRTQVLHKTIPNNSTHTTTLTELKKFV
QYDIQVLAYTRLGDGMLSTPPVRVQTFEDTPGAPSNVSFPDVSFSMARIIWDVPEEPNGE
ILAYKVTYLLNGSMSLNFSREFPPSDRTFRATQLLAERYYLFSVTAQTRLGWGKTAAVLV
YTTNNREIPQGPSSPQISRSQVQAEQITFSWTPGRDGFAPLRYYTVQFRENEGPWTVIPE
RVDPSITSYTALGLKPHTLYQFRIQATNDIGPSAFSKESIEVRTLPAAPSEGITGLKVVP
ITTTSVRVQWRSLPKNMWNGDAATGGYRILYQPVSDFPSTLQSTPKQDVMGVEQESAILK
DLTQDRNYEIIVQPFNSQGSGPPTPPVAVYVGEAVPTGEPRGIDGAPVSSTEVRLRWKAP
QQSMQNGELLGYKIFYLVTDSPQELEEGRKHEEEIEVVPASYTSHSLVFLDKYTEYRIQI
LAFNPAGDGPRSSPITVKTLQGLPGPPSSLSFSDITMNSLKVSWDPPRKRNGEILGYIVT
YETTEDNEKFSKQVKQKVSGTSLIIQNLEEEVTYTFTVRAQTIDYGPALSGNVTTGPQEG
SPVSPRDLLLSKSQAAVDMSWMNGPSGKGPILGYYIETKKRDDSRWETVARTTNGPIQEF
TVSFQSLLPSTAYKFRVIAYNRYGISCPVYSDDAILTPSKLYLEYGYLQQKPFYRQTWFM
VALAATSIIIIIMVIAVLCVKSKSYKYKQEAQKTLEESMAMSIDERQELALELYRSRHGV
TSQNGTLNGTSTLGRRTGTILGGSRKPQTSAAAAASLGKSPPRPSPASVAYHSDEESLKC
YDENPDDSSVTEKPSEVSSSDSQASESENESVRSDPHSFVNHYANVNDSLRQSWKRQKPV
RNYSSYTDSEPEGSAVMSLNGGQIIMNNMARSRAPLPGFSSFV
Download sequence
Identical sequences B0WHP3
CPIJ006669|sidekick|protein_coding|supercont3.127|111607|130832 7176.CPIJ006669-PA XP_001848227.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]