SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPIJ009217|roundabout from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ009217|roundabout
Domain Number 1 Region: 191-378
Classification Level Classification E-value
Superfamily Fibronectin type III 5.27e-29
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 2 Region: 49-162
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000298
Family Fibronectin type III 0.00059
Further Details:      
 
Weak hits

Sequence:  CPIJ009217|roundabout
Domain Number - Region: 2-34
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000276
Family I set domains 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPIJ009217|roundabout
Sequence length 991
Comment 1|protein_coding|supercont3.225|143180|167865
Sequence
MDLQPEDTDWYSCVAYSEKGETSWSAHLMVEKSPSSANLHRSSHSGDLLPAAPSVPKAVN
ITNSNVTLVWAKSGPSGDGQSDKLRNNPVTGYTVEYYSPDDKDGWVRAVSRIAANTATKS
YYKFSSQITNLKPSTPYLFIVRAENVHGYSAPSPLSNLIRTLSADDGVTMPEELEAARMV
LNGKILELVDAVAVSSTSVRLEWQLHISSTEEYIEGLYVRYRDLGSNSQKYSMLTIPNNA
AETHDITNLAKFTRYEFFLTPYFKNVEGQPSNAKIVQTLEDAPTAAPVNIQTGMLNLTAG
WVKWTAPPVEHQNGVLLGYKIQVKSGNSSKILASMTLNATTTSVMLNNLTTGATYRAQIV
AYNRIGAGPYSKASYLIMDPAHVIAPPRAHNSLSDIGGYRHHNFMHETWFMIFVVLALLI
ILTFTVVGVVVFFKKRQNMSKAIATVPVITSSEISSMNMNMNMNISRKDCLWIDRGWRST
DTDKDSGLSEMKLLEGSQNPSNYTDVGTDYAEVDPRSITSFYNCRKSPDNPSPYATTMIM
SGIPNENGKLPYQETYSSAASSVRSDVPYGPGHPKAFAMPYNAAPSNWIDFLPPPPEHPP
PIPQALDQHLQHLNHLNHLNHVVYPSELMGGGGNNATSSSQGSRYGVGGGDSSTMSSGHN
SSNELRSPPQPPTHLFLHQSHQMPLPPPPLSASSLTNGGTEVYFQDDIYNSPVKSCDQLP
THFRMPGSSSANSISCCPPAGRGGGGGPGMKHQDFLEYQQQQQQHQLGHLTPSELHIHHQ
KRLCGSCDALSPGPAPPLPSGGGLQKMPSSGVITNGSSSNGSHHGGPGDPHHLSNHHHQH
QLESGASFNGGTCSSDGSGRSGGTGGSSSSGSGGFSQRSKFARQMQHVNRENAVNGNYHH
HQNHNHQNGHHHHQKQQHQHQEPISEREETENDKMLNISSYSCEDGEDGTLSGNGPGHRG
GLGTDDYEDDTCCSCSDEGGSFLYEEPMQVK
Download sequence
Identical sequences B0WQ95
7176.CPIJ009217-PA CPIJ009217|roundabout XP_001850879.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]