SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPIJ009705|S-phase from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ009705|S-phase
Domain Number 1 Region: 84-159
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 9.94e-33
Family Skp1 dimerisation domain-like 0.0000127
Further Details:      
 
Domain Number 2 Region: 3-69
Classification Level Classification E-value
Superfamily POZ domain 2.17e-21
Family BTB/POZ domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPIJ009705|S-phase
Sequence length 162
Comment kinase-associated protein 1A|protein_coding|supercont3.256|500786|501898
Sequence
MPNIKLQSSDGEVFDTDVQIAKCSGTIKTMLEDLGMDEGEDEVVPLPNVNSAILRKVLQW
ATYHKDDPAPAEDDENKEKRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCK
TVANMIKGKTPEEIRKTFNIKNDFTPAEEEQVRKENEWCEEK
Download sequence
Identical sequences A0A1Q3F637 B0WSC9 Q0IEP2 T1E352
XP_001653700.1.48696 XP_001653701.1.48696 XP_001851731.1.94360 AAEL009160-PA AAEL009160-PB CPIJ009705|S-phase 7159.AAEL009160-PB 7176.CPIJ009705-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]