SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPIJ011455|tyrosine-protein from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ011455|tyrosine-protein
Domain Number 1 Region: 1983-2275
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8e-80
Family Protein kinases, catalytic subunit 0.000000159
Further Details:      
 
Domain Number 2 Region: 71-272
Classification Level Classification E-value
Superfamily Fibronectin type III 8.64e-25
Family Fibronectin type III 0.0035
Further Details:      
 
Domain Number 3 Region: 1650-1787,1837-1886
Classification Level Classification E-value
Superfamily Fibronectin type III 2.08e-22
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 4 Region: 1460-1648
Classification Level Classification E-value
Superfamily Fibronectin type III 2.38e-21
Family Fibronectin type III 0.005
Further Details:      
 
Domain Number 5 Region: 962-1149
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000133
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 6 Region: 676-916
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000000497
Family YWTD domain 0.0025
Further Details:      
 
Domain Number 7 Region: 313-526
Classification Level Classification E-value
Superfamily YWTD domain 0.000000000000051
Family YWTD domain 0.0036
Further Details:      
 
Domain Number 8 Region: 1156-1384
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000112
Family YWTD domain 0.005
Further Details:      
 
Domain Number 9 Region: 568-668
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000818
Family Fibronectin type III 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ011455|tyrosine-protein
Sequence length 2500
Comment kinase|protein_coding|supercont3.331|83483|106739
Sequence
MHLTGAPPPSSFVNRTGFNEHLDASCGSDCYLAQNKTDQDLLEPKELYCVMGCNDALNRY
FRWLKSMIGTPPAPALVADSLTATSLSLEWEVPKWLVQFSHYKNHSPQSYLVQWRYEEVA
GDWKFCRNQSMGDNSTIRVDNLQPYTKYRFRVALLLSPHHDEVLISEQSVIILTLAHGPP
MSEPKIVRAVAVDYSRISISWEPGPFPNGPVLSYVLQIKDIDPSGYSALKLNSSRYYIYE
KLNPDRNYSVSVKMRNPEGEGPPSTTYVQTPPQPLDLDEDIQPTLILGAERSVLSQGSDL
LSDPPTDFYRSPHHKIRGTAIHIRKNLIFVSDEAGNIVKAPLLKGAEKNRTVILTPEAGH
NFKPTLLSVDWLNDHLYILGQVTVNGLWQISRCDFNGDRMTVAIAGLQRQPIHFEVDPYN
GYLFWVIRTFYADAGLFRLDLGDISNGVKHEITPIQLINHHNLGAFAVEHTRFRVLVADQ
DSNTVLAISLDGKTIENIRNNTQSPRFKQVKAITYANELFYWTNGKEVIAEDLHKKQNLY
YHNAYPFALPITYFTICANLSSAQPIPVPVNPPRNVQALLTNKKIKIFWNVPHLLGIKGK
GAWQEWMYKLELVEETTGKVVAYPDITGTTFTSMDVELLKPGQEYVIKAAAYTPAGRGPW
GTEFRVRTLKDSHERHLLWSGSEGIMRSDVIGDGVETLISRTELEDGVVTDIAWFESILY
VVSNSSLVFYNQSESGIGKVRELESVECVTVDWIGRRLYYYNPSQQMIMRSSLHGDQHEP
IHNVKNVREIKFDALRGYIYYTSEFSMEAFRLNGKDKHSYYMENDRFTGKVVIGLTLDMD
NERVYWIVRSISNSELFSAHMAGTGSGKISSLVTVLSDQSPRGSLTHFSDRLLWLQHDEV
VVGDLQGKNLAHIKNQKLSGARAFTIIDPAHHIYPEDVQNINVLPMKVNDSSIRIQGTWK
KFSIVWDPVANVNYGKVFYKLTIKVKTRTEIHELSKTSFAFNSAGANFVPAHTEINVTIS
AFTYWRSSIFSSARLYSPSGKPSPPLRPRVFVKHFQNPIQNSHSIDATFRWSPPKNSNGP
IIGYKVHCSYEEDDTVKHVLQGELINGTERIVPNLVHNVSYSFRVQALTSAREGDLTAAQ
VVNTAEDHPIPQALIVTSEHVILYDFDSQQSTNVVGTSTPINFIVRLDREGKLFWVDENN
ELFQFYGSSKTKLHTISGPVQSLTIDWIQRVLYWSQLESVGSAIYAFDLNRSDKEGVHLE
RIVYRAGNMSNLVVSPMDRKLFWTERVPEDVIFVHSFEENKTEEFFDDSFEECPNRTAGI
TVHPVLTLQTSVDEEARLFWAETGAFRSIGLNSKTCMNFEFEYNPEMHSVAKDGDHFYWL
EKDTAFVRMDNGGSIESEKFDEIRTLLPLRLQYYPERRCLIPLQKEQDYQVKLLQRTEDS
LTLLLPKAEVHQNCTIEPSAIRYQIFYEEYRPVQTNETEECELRNCSLVSSYDRSTTIRG
LKPFTKYQFQVKLVNYYQEQIGLTQDLLESPRLGSPTVFSTAAGAPSTPENVSAVAISPT
EAVVHWSPPKVKNSDRVWYEIHWQTENIHDGLKNRQQQTFVDFDETLNHLSMNLTRLQPS
KAYTIWIRAYSSNTTFSESYQVNIVTFPEPEEIMLQSISSTELSVKWRPHVNISTYKLQY
SAMGSKVWETVFETGVNVSSPEDDIFQVTELQPKTQYRFIVLLFYPNRQDPYMWPSDTKF
IYETEADRPSAPGRPIVTQIRQEFYRVIWEAAKDNGAPIQEYALEALVRSPRNTNRVERS
AVTAAGSAELEDYGEEDMNNTIPTRVDVSSTDSEEYETFDEHWEQVYNGTEVYWFIPENR
PLHKHTFRVRAKNSCGWGPYSGESEPISAPLISGQASSFLIIGVIAASSILLLIFVLICV
CACRARAEKEKNKFIDATNTTRIPDVELANLRELPRRGNFIHSNNILYSSGPLTDSEIAL
LPQIRRDQITMTRFLGCGAFGEVYEGIVKGFGAEAETSVAIKTLRKGATEQEKAEFLQEA
HLMSNFKHKHILKLIGICLEFDSLLIVMELMQGGDLLSYLRSNRPTPGVPSSLTLLDLIS
MCVDVATGCRYLEETHFVHRDLACRNCLVSSPDPKDRVVKIGDFGLARDIYKNDYYRKDG
EGLLPVRWMSPESLVDGVYTSQSDIWAFGVLLWEIMTLGQQPYPARNNVEVLHYVRGGGR
LGRPQDCPEELYQLMLKCWSYSPEDRPTFRYLLEVLKSLKERTSDSIQITSQFPCKVQNG
AIFNRSYLLSDINHNPFMADIKFGSSGSGGAFIITPPTSSSGSGATVMTTTIPKYLELVY
NDNHSSNSKCSTGEDVPLTTGLTVALPNCQQPMGEMTDNGYEIPIHDIIMRQQQSPAGSF
KGRTFSSSSTVSNVSTLPASAAGTSGTHHHQPPRIDDCSSLEALLPINSILTVRLPDEPE
SLPAQAPSPTVDSVAENNSISGKEQSQQVSLPAEECKTVM
Download sequence
Identical sequences B0WWC8
CPIJ011455|tyrosine-protein XP_001861700.1.94360 7176.CPIJ011455-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]