SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPIJ012939|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ012939|conserved
Domain Number 1 Region: 61-101
Classification Level Classification E-value
Superfamily GroEL apical domain-like 0.0000017
Family Group II chaperonin (CCT, TRIC), apical domain 0.019
Further Details:      
 
Weak hits

Sequence:  CPIJ012939|conserved
Domain Number - Region: 253-284
Classification Level Classification E-value
Superfamily ARM repeat 0.0575
Family MIF4G domain-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPIJ012939|conserved
Sequence length 324
Comment hypothetical protein|protein_coding|supercont3.435|364737|366855
Sequence
MQRASYCVAARITTVLLASIAKEQDNSRDPEKVFCWTRIPVCISRVLTIVHADSDGIKRL
ELDQVWLGRCDLIEHVMIGEDKLLRFSEVPLEEACTVVIRGATQYDALCTLAATVEETLG
KEFMAIQSFGRAMLSYESRQRVISSVDSFSCYWSETSQSLDQLHRFAQHPTGPVNLELHN
TFKADGLGKVFIELKAEAELGKPEIKPEPDPKRLPFYYLTHSIKIPLHFFSLLNSFRVRR
SNCQRTFANYETRTVKAIKKNLKKCKWDAARYALHLLADLFNCHRRGELETTEQLVLEDS
IGNQKRSWRQLTDKTKSKRTHDWH
Download sequence
Identical sequences B0X0X0
7176.CPIJ012939-PA XP_001863292.1.94360 CPIJ012939|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]