SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPIJ013199|tyrosine from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ013199|tyrosine
Domain Number 1 Region: 888-1174
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.62e-99
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000015
Further Details:      
 
Domain Number 2 Region: 1171-1410
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.03e-57
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000338
Further Details:      
 
Domain Number 3 Region: 267-454
Classification Level Classification E-value
Superfamily Fibronectin type III 7.23e-27
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 4 Region: 474-614
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000523
Family Fibronectin type III 0.0058
Further Details:      
 
Domain Number 5 Region: 156-237
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000011
Family C1 set domains (antibody constant domain-like) 0.057
Further Details:      
 
Domain Number 6 Region: 34-69,113-135
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000843
Family I set domains 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ013199|tyrosine
Sequence length 1422
Comment phosphatase 69d, drome|protein_coding|supercont3.438|26722|46613
Sequence
MWKNQAHLCFLVVCIYSLSHQIVEVRATGSTVEPRYFLAGRNGTLSCKYTGAEIPTWHKD
GKNLTDGSGKFSFMIVDSERDVEKLSDGDEGKPAEEQQSDTTDASVLPANTAISTLTIHN
FTKADTGKYVCHGEGKSILANYTVHEVILPKITASSPERTRTKLEKKVELYCVIQMYPLE
YFNNSIQWFKEDDTTENNFFKNTSVRILNGTHVNVTLTIAGVSKTHNGTYSCNVGPSAML
DESSAVDKKSMALLVLDKPQVAIEYMKAVGANKIYLNWTINDGNDPVKHYMAQFMKKGDS
TFTYYATRIDGQNTSFVLENFEPATDYEIKLTAQNSQGSGPASPPQKVRTLETDPSFTPV
VEVKGNTHSTITIGWAPPPTDLLEYIQYYDLTVSVAGENSSKWETYYPQNSRNLPYMFDN
LETATEYSFRVRACSELAKVCGNWSEEVNGTTSDGTSSEPLDLNITCSHFNISRRNSVRI
HWNPPSKPNGKVVSYQVILDGLSQYRSEHGTLKNETWGPKIKNVQAQFTKTEYDGIPPNT
NYTVRVAAVTRTKRPGKMASATCTMPSTTPDNIGRLMWGKLRTEDNQWIFKLFLPRVSER
NGPICCYKIYLTRLVHKNGSLPEPENLAVTSYADVHSLNNTHGGTYLAEIFSSVNYSSEV
FLGDGKNNEVQDLTFCPQCLHKTRFHQIDKTSAINKDEEEVGQNATATTTTANPIRTGNE
AVSVQDELKVSSHEKREITSYNSYDGGTYQLETVYDGVLDATSNYTGFVEVVVKTEGDSG
PQYISSFSEYFQEMNAGAPSPSELNGKDLSFILNIVIQILCGLILIVLLVLLTLCLLHKH
FSKNIAQEGEAISLGDSLRRALCHGRNANMHHRHLLGSNSVKPPTIPPISKDDLPKAYYE
KHKDSDYGFQHEFELLPDKFVDRTTKNSDLKENIHKNRYPDIKSYDQTRVKLSTMNGLCG
SDYINANFVIGYKERKKFICAQGPMDSTINDFWRMIWEQHLEIIVMLTNLEEYNKTKCAK
YWPENINDSTQYGDLLITFTSDSFYADYIVRNLKVTKRSVNSAGDEVEDTRYISQFHYLT
WKDFMAPEHPQGITKFIKRINSEYSLQRGPILVHCSAGVGRTGTFVALDTLTQQLNEEGQ
VSIFNTICDMRYQRNFLVQSLKQYIFLYRALTELAYFGDTEIDQKSLATTVENLKQPSTE
NADICKLEAQYQRIKSFQDDTRRTVAIGSSEENKAKNRSDSCVPYDKNRVILAPIPGHDN
CTYINASFIDGYDDENNFVITQDPLENTIFDFWRMIFEQRIKTIVMFSEIGDGPNKCPRY
WADEEMQYENLLVTYIQSESGPYYTKREFTVTNCKTKDTIQVTQFQYNGWPTVEGEVPEV
TRGMIEIVNQAQKHSTQQEDMFTIAVHCRARKSELTLKFGLE
Download sequence
Identical sequences B0X101
XP_001863323.1.94360 7176.CPIJ013199-PA CPIJ013199|tyrosine

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]