SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPIJ014077|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ014077|conserved
Domain Number 1 Region: 34-94
Classification Level Classification E-value
Superfamily GroEL apical domain-like 0.00000123
Family Group II chaperonin (CCT, TRIC), apical domain 0.0089
Further Details:      
 
Weak hits

Sequence:  CPIJ014077|conserved
Domain Number - Region: 218-289
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00125
Family T7 RNA polymerase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPIJ014077|conserved
Sequence length 303
Comment hypothetical protein|protein_coding|supercont3.513|201137|202294
Sequence
MLSEAEKLLEQKFHPQTSAAKQAPKLFAGCCLEDSFLDKGFLLDKKTVVHKPKCIVNAKI
LIANTPMDTDKIKVSMVKIAELEVAEKEKMKDKVITRTRLFSVVAICSKVCIDVIARSNI
CRTRCRNISQGGKLLPNRNFAPKLYRTFRSQRSIDILLGIGILVRLVAKQSGALQLENLK
FKVLLSAADENLEKLSSNSSGKSRRGMRCGKVKESASAAKDTLNQLGSIPWKINSEVMAL
FIRAASPCWTFPALLIANRRNQEETVPRSELTGYDWFILMRKKMTHWRKAHLIPPHLNHS
LSP
Download sequence
Identical sequences B0X3Y8
CPIJ014077|conserved XP_001864360.1.94360 7176.CPIJ014077-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]