SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPIJ014382|fibronectin from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ014382|fibronectin
Domain Number 1 Region: 521-712
Classification Level Classification E-value
Superfamily Fibronectin type III 1.52e-35
Family Fibronectin type III 0.00094
Further Details:      
 
Domain Number 2 Region: 323-521
Classification Level Classification E-value
Superfamily Fibronectin type III 2.76e-33
Family Fibronectin type III 0.00013
Further Details:      
 
Domain Number 3 Region: 711-848
Classification Level Classification E-value
Superfamily Fibronectin type III 1.29e-27
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 4 Region: 822-856,927-1061
Classification Level Classification E-value
Superfamily Fibronectin type III 1.86e-26
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 5 Region: 220-330
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000615
Family Fibronectin type III 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPIJ014382|fibronectin
Sequence length 1185
Comment type-III domain-containing protein 3a|protein_coding|supercont3.528|59488|65465
Sequence
MINGTTPQYFNPLAAGYQAGPGPGGPHIYQSPLITGGGQAAAAAAAAAAAGGGAGTHTIH
TAAGAQQSNVTHSPSPPHSNNNQYHKDERTQRQHTKLLRKLEQKHREVLNAALTTQLPPS
PRKHTEVNGNARKHQQNQQQQQHLQLHQQHPLQHLHPGLLQQHPHLHPQQQNPNQNHQQQ
QQPHHRNGTSSQDTSEDGEESSSMPDEEDDNTQSIVEHLSSVPSPQVNEITSRSALFQWA
APSPLPPHESLPFNVHDLHYELLLSDPGKENKYKSIFKGSSLSCMVQDLRPGQEYTVRLQ
VYLEQLHGSPTEASTFNTPPCEPDTPKTPTLIARTKNSLQLRWNAAVDNGSHITNYILEY
DNGKYNGMIHLINAQNCDFVEVCKTKGKQFTVNKLHPSMCYIFRLSAVNEYGRSGYSDLV
KFNTAGNPPPQPAPPTLQHATAASLKLAWQRRSPSEGFTLQMNDLDLGYGYKNIYTGMDT
VYECVGLRRATTFQFRVKAENENGQSPFSKEVVFKTLPACPGRPTKPQVKGKIHATAFKV
KWDQPMDTGGADIQLYHLEISSGAMYERIYSGKESETMIERLSPGTAYQIRVLCEGPGGI
STFSEPSTVTTEPVAPRPPQRPYCSGAPTPYAACLMWDKPDYNGGAPILEYEMEVELTNK
TRQSCYRGKDLFCVVKDLRPGEMYTVQVRAYNRIGAGEWSEEYSFHAGAAPPNAPKELTI
TLKSPTHLTVIWDEPHCNGAPISEYILQSSTAPDAEAEQSLFQTVYHGQQRTAELKNLAP
FTNYHFRVCAVNSAGSSRYSTTFSQKTPAAPPNVPVLGQHKITAKSILICWETPQSNGSQ
ITHYNIECGDRVITSDAASTLCRSTRTRTSGDHSKRSARRDEEDDEAVSDADEDDSDPEE
EEEVEDDASEAASIASATLAEKANRNELLIEDLHPESVYKLRIQAVNEIGTGPFSGYIKF
TTAPLPPKPPKLECIQHGFSHLKLRWGEGKNLVDLARYYVELENARTGEYQNVYTGTRST
CKVMKLHELTPYTFRIAVKTKHAGMGDYSEDFVFVTSAATPNTIKAPRVYIEPLNGGGSG
NNSPAHPPSSVNGSVSNLNTIVQGSTHLTTGQTTAAGGGAGGAGVLTIEWQTSRNNPFAD
AIEYVLQIAKSKDQDFQEISTRFDLQLVGDIRDYHLRLRTLWADW
Download sequence
Identical sequences B0X4G2
CPIJ014382|fibronectin XP_001864534.1.94360 7176.CPIJ014382-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]