SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPIJ017714|bruchpilot|protein_coding|supercont3.990|7617|18012 from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ017714|bruchpilot|protein_coding|supercont3.990|7617|18012
Domain Number 1 Region: 303-550
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000015
Family Tropomyosin 0.00045
Further Details:      
 
Domain Number 2 Region: 112-334
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000589
Family Tropomyosin 0.0011
Further Details:      
 
Weak hits

Sequence:  CPIJ017714|bruchpilot|protein_coding|supercont3.990|7617|18012
Domain Number - Region: 1138-1293
Classification Level Classification E-value
Superfamily Tropomyosin 0.000425
Family Tropomyosin 0.0053
Further Details:      
 
Domain Number - Region: 612-708
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00324
Family FCH domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPIJ017714|bruchpilot|protein_coding|supercont3.990|7617|18012
Sequence length 1391
Sequence
MVKTFWNDYTDTLPLRKRLIGVQIPARTNTTGDLFPSGIDCLVEELRNRLEEKNRMIEKK
TQSAMQSVQDKNRVQTELTELKEHMDIKDRKINVLQRKIENLEDLLKEKDNQVDMARARL
SAMQAHHCSSEGALSSLEEAIGDKEKQMQQLRDQRDRAEGEKKEERELHERELAEYKMKL
HTLDSEVEKLTSRLHRALNEKDRLESKLECSQSELGKSKAELDKAATDVGRSGSDWENAK
QRISRLELENERLRADLERSQTTFGRSTLSTSQELDRAQERADKTSAELRRTQAELRVTQ
SDAERARGEAAALQEKLEKSQGEVYRLKAKLENAQGEQESIKQEMERSQTGIQRIVSERD
KAYAELDKIREELERSQATLGKSQLQQEKIQNALDKAQNEVDHLQEKLDKSVGEVRRLQL
EKEKINYEFENIQSQLDKQLGQSSRVQKEREAVQMDLERYRDKADKLQTALSRLQKERDI
LGDELEKLKEKAEGTQSSALKYQRERDAIQTELEVVKERWEKAHQIHQKLQMERDDAVTE
IDILKEKLDKALYASQKLIDEKDNSNKEFEKMLEKYDRSQNEIYRLQSRCDTAEADRNRL
EVEAERSALAAAKAKEDLRKLQEETTRLQEACDRAAMQLGRSKELEDKAKEDVDLIRERL
DKTQADLRRAQAEKENIQAEVERLTYELDRAHNSYTKQTASLDAAQEEAARYSLEIEKMR
ERYEKTAAEMRRLQENESFSRESRRLKEENDRLREKYDKMMMELENFRSKSQYEEETLEK
FKQKFELRENECQTMELKLHEATLQLDLARQEVQKLIASQDKQRTDAERAHIEYEKIRDK
HEKLLKEMERLRQNPGSAVSPGALAAASVGMGDKNEIDRLRDRLEKALQSRDATEMEAGR
LAKELEKAQLHLAKQQEAYEATRIEFERMSAELTRVLERLEKSEAEKETLRQSTKIYEKH
HQQHAACNNIDQNVLKIEADNKQLMAERDQLVMQLEKSQDMLMSFQQELNAAELELQRQC
EENRRLKNSPQGAHGQPQNNSQEIQNYKKEITRLKQMLQETGARGDSELEQWRKVVEQEK
NRADQAEKAAIELQKRMQVMEQQLKQQLLQMTNMQKQMTQQQPPQQPPQPQQPQINPKEM
DKIQEELKNAVTQRDQFQNQLELLVQELEKSQLEAQDAAKKAQQQHQKLQQMEQQIQVLQ
QELQHATQAANQKAAQQAGISEHDRKQLEAQMKQIEDATRLLESERKTFEDQRKVIENKR
KELEEKEKNLVEFDKQLKKRKEQMDQLEKSLQKAGGTAAAAGELNKQLTETQQQLDKITK
DFNEAKEDAQRSAAETERLLQLVQMTQEEQNQKEKTIMDLQQALKNAQAKLKTAQAQPQD
AGPAGFLKSFF
Download sequence
Identical sequences B0XE40
CPIJ017714|bruchpilot|protein_coding|supercont3.990|7617|18012 XP_001867912.1.94360 7176.CPIJ017714-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]