SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPIJ017939|contactin|protein_coding|supercont3.1038|112378|116740 from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ017939|contactin|protein_coding|supercont3.1038|112378|116740
Domain Number 1 Region: 563-774
Classification Level Classification E-value
Superfamily Fibronectin type III 3.38e-28
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 2 Region: 777-969
Classification Level Classification E-value
Superfamily Fibronectin type III 2.18e-27
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 3 Region: 373-463
Classification Level Classification E-value
Superfamily Immunoglobulin 4.22e-19
Family I set domains 0.019
Further Details:      
 
Domain Number 4 Region: 200-277
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000519
Family I set domains 0.016
Further Details:      
 
Domain Number 5 Region: 274-370
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000429
Family I set domains 0.017
Further Details:      
 
Domain Number 6 Region: 470-568
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000153
Family I set domains 0.035
Further Details:      
 
Domain Number 7 Region: 2-79
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000571
Family I set domains 0.015
Further Details:      
 
Domain Number 8 Region: 102-162
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000121
Family I set domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ017939|contactin|protein_coding|supercont3.1038|112378|116740
Sequence length 977
Sequence
MLSCLAGGYPIPTYSWYRELYTNDNVTVVKLDPLKNSRYTTSGGSLIIHDPQQIQDQGTY
HCIAENKYGKIISESVELNFGYILEFNLQRSSENGEMNWGKSLYCDPPQHYPDVRYYWSR
TYFPNFVEEDQRVFVSHDGSLYFSSLEIKDRANYSCNVQSTVSDTGRNGPFFNLQVVSHP
HYQDLIFANTFPKIYPEAPVAGKDVRLECMAFGYPVPSYNWTRKSGNLPRQSYLESYNRV
LVIRNSTANDNGEYTCTIKNDRKFLSKSILVNIQMEPNFTIPLKDKLKDFQSSVTFLCEA
TAIPDVNYTWYKNAQLMDPESSKFNKDKYIIQDNILKINFLDPEEDNGMYQCKASNQLKG
VYSSAQLRVLSMKPSFKKKPLESEIYSIYNGNTTIECEPEAAPRPKIVWKKDGNVIGSGG
HRKILPVGTLYISPTSRDDEGVYTCVASNTQGVAESKARLIVLQELRFIEQLPPKLIKQI
DEMLYLRCDVSYDEVLDVAFLWAHNGRLINSDDDVFRNNSRFFVNNNHLEVHNLTLLDSG
EYECIVKSAVNQVVSKTNVFVQGPPGAPGAIKVIDIKKTDAVLEWIDGSDNGRQIMFYNI
LGRTTWNKTWVNISENVVAQEIDRYNGRKRAVVNNLTPGCGYEFSVMAVNDLGGGTPSLP
SPLYNTQKDKPYLFPKNIGGGGGKIGDLTITWTPLLPEEQNSIDIHYKVFYRLLGQKEFA
TDVLKNRGNTGKAVVHIPSDKYYTKYEVKVQAINDLGDGPVSDIAVIYSAEDMPQVAPQQ
TIARSFNSTALNVSWVSVPQTRETIRGKMIGHRLKYWKKEHKEEDAVYYLSRSINSWALI
VGLEPDTYYFVKCMIYNGAGEGPESERYLERTYRSAPQKPPSSVNIFGINPSTIRVVWRY
IAPSQDEEPVQGYKIRIWETDQDMTTANDTVVPIGNKLEKYIDNLTPGKSYNLRVLAYSN
GGDGRMSSPPLKFQMGM
Download sequence
Identical sequences B0XEP8
XP_001868120.1.94360 7176.CPIJ017939-PA CPIJ017939|contactin|protein_coding|supercont3.1038|112378|116740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]