SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPIJ018780|ribosomal from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ018780|ribosomal
Domain Number 1 Region: 314-372
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 0.00000000000000235
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.012
Further Details:      
 
Domain Number 2 Region: 371-401,487-516
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.0000000000201
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.01
Further Details:      
 
Domain Number 3 Region: 395-494
Classification Level Classification E-value
Superfamily GroEL apical domain-like 0.00000000164
Family Group II chaperonin (CCT, TRIC), apical domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ018780|ribosomal
Sequence length 539
Comment protein S6|protein_coding|supercont3.1286|915|6175
Sequence
MDLVQSISSKEFNGTEFQQPQVAKQQTRSAGSTDAISTRCCNVDQNLALNILREGEKNIP
GLTDTTMPRRLGPKRATNIRKLYNVTNFVEKCPLPEKDNKKTKSNTPKIQRRLAIKKCCV
ESRPSAGPAPSERICRRNRLSSMRESCSSVGSEKEKNKSIVKAAKKVTEVSKTAKKSEAG
KKAVTGDKKEKKILKKEAAAGTWHCGFCLLNCLPMSRLLLRRRLLQRKPDPVVKLLLRSN
LLTLRGLLLRLLLLVVLLAKLRHSIFFQFSFCGSVLISFDSKAKIAIFMSTTGKVCSGVI
ARLSSFVGAIAIGKLDDEVGDGTTSVTVLASELLREAEKLLEQKFHPQTIIAGWRAAKQA
ARSALFATVTPSSEILSRRSEILAVDAKTGGCLEDSFLDEGFLLDKKPVVHKPKRIDNMK
ILIANTSMDTDKIDGEDCRAGGRREGEDEGQGDNQDQARLGRCDLFEQVMIGKDTLLRLS
GVSLGESCTVVIRGATQQIIDEADRSLHDALRVLAAETSGERVIHMTIEVRCSDGRTWK
Download sequence
Identical sequences B0XH45
CPIJ018780|ribosomal 7176.CPIJ018780-PA XP_001868967.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]