SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPIJ018832|sterol from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ018832|sterol
Domain Number 1 Region: 299-361
Classification Level Classification E-value
Superfamily GroEL apical domain-like 0.000000000136
Family Group II chaperonin (CCT, TRIC), apical domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ018832|sterol
Sequence length 397
Comment regulatory element binding protein cleavage-activating protein|protein_coding|supercont3.1349|33204|35171
Sequence
MHDLRSADAAGHLNLNHFEQRADSERHGAVDRLRHPDYETLSNFHLSSILKQYNVSLSGR
YVTVLSSIIARAQKLSHLDEKVPHHFHWKALAAALDPPDLNDADTGNVPYINTVNALFYP
ETPKEILLCCMLIAVSFFMITYHTEWRASWTANSENEQEQPPTSFAFKLKNPNQCQEPKT
GHLRGGAHPQQRGHQHHQHLTWDKVVTARLSCRIDFLRLETYTQGRQIDWGFTSAYQRTR
IRTGSAGCLSMFQQPNGPANVHHASEEELRCILEFHQQGHQMPVTCLEVAGGTVRPAPAK
AQLDVTSAKDYRKLREYEQAKFLSMVKQVKEAGATLAIWQRGFDDEANHLLLQQELPAVR
SGRIVPRLIGLNYTHEVELKATSMTCALLLVEGYDGE
Download sequence
Identical sequences B0XHI4
XP_001869106.1.94360 7176.CPIJ018832-PA CPIJ018832|sterol

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]