SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PAAG_00386T0 from Paracoccidioides brasiliensis Pb01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PAAG_00386T0
Domain Number 1 Region: 17-109,250-322,355-482
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 9.07e-62
Family IF2B-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PAAG_00386T0
Sequence length 498
Comment | PAAG_00386 | Paracoccidioides brasiliensis Pb01 translation regulator GCD7 (499 aa)
Sequence
MSPAAVALTPGLQSFLHTLKTSDVESATENLISLLKRRQIQPSHSCAVATAYLLLRVVST
SCITDPAKLIDRIQYVGKRLIAAHPREMVVGNIVRRVLGLIREEAEDERDGESCLSSDAS
YDTRPHTPHVAATDAGGNHLITQPPDISTVTTTTTAAAAAAAAAHVSSPLRREGTDIDEA
LPSGKRGTSLAAIRSETTERSSRPPNIQAPPVVSMFRLLSHPQVESLQVGSPITGSPSGR
LPGSYSSRDFRAEVIDGIGEIVDELGQVEDQIASYALEHIHSDEVIMTYTSSVTVHKFLA
KAAAKRKFTVIHAEGYPNDHIATHRTVAGTTSAAASGVSGGGACGDDESLSLSTESFQKS
LTDLGVTVILIPDSAVFALMSRVNKVILGTHSVLANGGLVAAAGTRGIANAAKVHQIPVI
VVSGIYKLSPVYPFDYEALIEYGDSSAVLPYEDGDVGKIDVENPLYDYVPADLVDLYITN
FPPSSSGNEVPANGRHRR
Download sequence
Identical sequences PAAG_00386T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]