SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW001386-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW001386-PA
Domain Number - Region: 34-111
Classification Level Classification E-value
Superfamily MetI-like 0.0193
Family MetI-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW001386-PA
Sequence length 123
Comment transmembrane protein, putative|DS640459:11365:21335:-1|gene:ISCW001386
Sequence
MDLRDAEYRPLFGGPVDRPLFDESNVRERRIHVLIAIFTVILVLITLILAFFYSVHPPCG
RHIYFALCILCLCFTHVILIHWYREGNVLDPKFRKLIYANTVIIVLFCISAISYFVEGCS
GKA
Download sequence
Identical sequences B7P5F1
XP_002407315.1.51680 6945.ISCW001386-PA ISCW001386-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]