SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ISCW002640-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW002640-PA
Domain Number 1 Region: 30-60
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 0.0000759
Family D-aminopeptidase, middle and C-terminal domains 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW002640-PA
Sequence length 72
Comment hypothetical protein|DS684747:12934:13152:1|gene:ISCW002640
Sequence
MGGLGIKPRSLTDWLLVAIGPEPREQATSGADRERGLLLDVGEAHQGRRSLRFGTADRFV
SFLRAKTCVRSL
Download sequence
Identical sequences B7PCM6
6945.ISCW002640-PA ISCW002640-PA XP_002410022.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]