SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ISCW020877-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW020877-PA
Domain Number 1 Region: 102-281
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.46e-34
Family C-terminal domain of adrenodoxin reductase-like 0.0000128
Further Details:      
 
Domain Number 2 Region: 21-153
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.000000165
Family N-terminal domain of adrenodoxin reductase-like 0.0000967
Further Details:      
 
Weak hits

Sequence:  ISCW020877-PA
Domain Number - Region: 275-372
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.08
Family N-terminal domain of adrenodoxin reductase-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW020877-PA
Sequence length 377
Comment NADPH:adrenodoxin oxidoreductase, putative|DS838036:165208:190136:-1|gene:ISCW020877
Sequence
MVHCLPALTEPILEIRRLRQQHPGATVDIYEGLPVPFGLVRFGVAPDHPEVKNVVHTFTN
IAKNPRCHFYGNVRLGLDVSLADLRKAYHAVVLTYGADQEKNLGIPGEVSIVFASRRFTY
YTRWXXNPDLSGNTAVVIGHGNVALDVARILLSSPERLQMTDIAEPALAALRRSNVRRVI
LVGRRGPLEVSFTIKELREMTKLPGVGTVLRAEDFAVVRDKLADLPRPRKRLLELLLQTA
EKQHADHPDRAWELRFLRSPARFVGGSEGGRVSAVEFSINSGWVKTGPVGVLVATMNSSF
ETGQALVKDAESGLLPTSDDRGGSATILQLLESNDVTPVTFDQWLKIDEWERTEGSRRGK
PSEKLLSIEQMLKIARS
Download sequence
Identical sequences B7Q1I7
ISCW020877-PA XP_002409712.1.51680 6945.ISCW020877-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]