SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ISCW021579-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW021579-PA
Domain Number 1 Region: 246-303
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.05e-21
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00014
Further Details:      
 
Domain Number 2 Region: 1-37
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000249
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00064
Further Details:      
 
Weak hits

Sequence:  ISCW021579-PA
Domain Number - Region: 197-252
Classification Level Classification E-value
Superfamily ARM repeat 0.000167
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW021579-PA
Sequence length 303
Comment tfiia large subunit, putative|DS861322:110478:127953:1|gene:ISCW021579
Sequence
KLYRSVIEDVINGVKDIFLDEGVDDQALQELRQIWGKAANSTDNLHAVGEPQYDWVMKPM
GDQQQHQYTVVTTGGQPVVTTTASPSTVTTVLAPPPSTTTSQVSGTSIQILLCYRTGQSS
VDAELAHAGQSSVDTGLSLLSIWPKQCRHSAICAIALTLNTIALVYDVITLAKAALIQSL
PSHHTDQSSISAESTLDGANDTSDEEEEEDEFQDNEEDKEDNDDDQADEDNEDEGDEEEP
LNSDDDVSDEEATENFEIDNVVVCQYDKISRSRNRWKFHFKDGIMNLQGKDYVFQKAVGD
AEW
Download sequence
Identical sequences B7Q5G2
XP_002411755.1.51680 ISCW021579-PA 6945.ISCW021579-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]