SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ISCW002572-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW002572-PA
Domain Number 1 Region: 9-63
Classification Level Classification E-value
Superfamily L27 domain 4e-25
Family L27 domain 0.00015
Further Details:      
 
Domain Number 2 Region: 80-147
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-19
Family PDZ domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW002572-PA
Sequence length 204
Comment receptor targeting protein Lin-7, putative|DS652957:298672:308443:-1|gene:ISCW002572
Sequence
MAAVGETLMLERDVKRAIELLEKLQRSGEVPAQKLAALQKVLQSEFCNAVREVYEHVYET
VDISGSPDIRASATAKATVAAFAASEGHAHPRVVELPKTDEGLGFNVMGGKEQNSPIYIS
RIIPGGVADRHGALKRGDQLLSVNGVARLHICVQMGSTAWQPVLTVYDQRARQCHLSGGV
GAPAVCVHIVCRSFAVVKIILVML
Download sequence
Identical sequences B7P7Q2
XP_002399452.1.51680 ISCW002572-PA 6945.ISCW002572-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]