SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ISCW004526-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW004526-PA
Domain Number 1 Region: 511-787
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 5.49e-47
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0034
Further Details:      
 
Domain Number 2 Region: 196-501
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 3.66e-41
Family Lipovitellin-phosvitin complex, superhelical domain 0.0017
Further Details:      
 
Domain Number 3 Region: 4-169
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 9.02e-22
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW004526-PA
Sequence length 788
Comment conserved hypothetical protein|DS710131:70613:87540:1|gene:ISCW004526
Sequence
FKEALEKYPVLFHMEEGIIGDVRHDPSELPWAMNVKRAIMSMVQIPRTTLDANSIVSETD
IFGTCETKYSPANGGILKKSKNLATCLGRFGSSLPIIYTPYESKNSPFQTIPMTNGTMDC
QMVVDSNRWITKSECKEREFLRLAARGMAEETLITSTMVLILQQQTPGIKPVPATVNMMS
SLKFDHSVTRVEKTDIKDVMGILRDLCRSTAEDIRPEASASFSRMVAALRGLPHEHLTQI
YAKIVAGEICFDRKMEALYLDALPMIGTEASLKQTVELMNKAEHASRLTAWIAGLSSISY
PTEGMISVLIPMVKKPNAPRNLILAVTSMAHIFCREESRNCDEVPAIKELQGALTKILSY
KCRATDILSRNKIITALKGFGNLGYHGEAINSIMECAIAANNPLPIRLAAIESFRRSCTP
EVQSKLLELMKTTTEDVEIRIASYLGVMRCPSFKDIVEVVKMVGDEQTQQVLSFIMTHLS
NLQETESPMKMNLRSLVSSLVIRSKIDSDFRKSSQNIEWSDYSEKFNLGATADANIIYHP
KSFIPRSLMMNLTVDLFSHSINLFEVGGRAEGYDHMLESLLAPKRQIGNSHKTDSFWSRL
GEKLRRSRRASPKTTKVNIMKPNQPSGSIYFKMFGNELAWFELPTMDDISNFADGVATNN
WMSREKQMDIARSAMLIDTTVTVPTVTGFPFRADIKATVTAGLKSDGKLNLEGAPKDMLI
EGFIKPSAAIDLTRVMSIDVGVAKRGIRVTSTIHTSTALDGKVEIKPTGEINLKYNMRQE
KQEILNLK
Download sequence
Identical sequences B7PH02
XP_002401765.1.51680 6945.ISCW004526-PA ISCW004526-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]