SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ISCW009032-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW009032-PA
Domain Number 1 Region: 248-576
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 3.92e-45
Family Lipovitellin-phosvitin complex, superhelical domain 0.0000957
Further Details:      
 
Domain Number 2 Region: 21-231
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.28e-44
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0016
Further Details:      
 
Domain Number 3 Region: 699-1042
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.65e-31
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.014
Further Details:      
 
Domain Number 4 Region: 569-626
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000000000204
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.024
Further Details:      
 
Weak hits

Sequence:  ISCW009032-PA
Domain Number - Region: 3993-4106
Classification Level Classification E-value
Superfamily vWA-like 0.00104
Family Integrin A (or I) domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW009032-PA
Sequence length 4257
Comment hypothetical protein|DS847994:630625:680542:1|gene:ISCW009032
Sequence
MKTAVLLACAAVAFAESRKFDYKPGTTYVYSYTTSTETSMQGTTSDKAAVYLSCQVELES
LGGCDYTIQALELNPLKFSYEDGRVENICPSEGDSPRVLNIKKGILSVIQNSMQRLEGNE
DIVEVDISGKCPTVYETLPKGWTSLTIRKTKDLSQCKDRESSITALQATAEEGNLRSMPV
VKGEQECKQTYKNSILESVECKEKHVVRPFSRQENGAVTNVFQSMTLRTQRRSVPSRTIY
TAAPETDMLFDHDYDVEEAARTLARAEDVLRQLVDSSGEVIQSSAPGMFTELVFSLRKLN
NKDLQTVFHTARNLSPKAKKFFMDALPSVATAASVRMMTESMVNGEVIGIDADAWLTSLA
FVSQPTLEMVKEALPLIKLDRSQAYLGVSTLAHSYCRANPDCNSAHPIKELARSLYLTLG
ENCYARDARTTLMVLKALGNLGESEGSEETLHRCFQNPQLDIEIRLAAVEAFRRFSCDIP
RNEMLRTYQNVHENVELRIAGYLAAIKCPSNPVIESVRDAIRNESIKQVGSFVYSHIRNL
AKEPSPFQTEYRAIANDVELKNKFELDFRKFSRNIHYRMFFDPLDTGFELDANVIYTPES
YYPRSLMVGTSFDIFGKKINLFELSMLMSVDAHKSVSGVKMVATMSSSWVVDGSLQVQQG
QAVKAQINMPRNEMELIDTEYRAIANDVELKNKFELDFRKFSRNIHYRMFFDPLDTGFEL
DANVIYTPESYYPRSLMVGTSFDIFGKKINLFEAGARAEQVDKYIQKWFPLDQQNTIRSR
RAISDNKIDELGKKFAVKEKYGGDAKASGYLRFFGNEIAGIQIGGNAATPFNELSEWIVK
MSDSKGLDLSKSVLFADTSLTVPASNGLPLRVSVNGSATAAISVGGKSQMKKGGVDINGQ
IKPRMVDVKGAMVTMSTPGTTMDREIKAELQHNIRDRSVALRLKTPPKKFTLEGKYNFDE
KLKKIDLSAKLDEASIFQLVSELKADTSQVVDLDMMDKNRVKYEAVIKSFFVDGKMDGYT
QSGENWATKMNGEFSLMEGRPEKIDFTAKFRDLSAGSLTKYNGAASFQNTFHPSLNTDLL
WDCQVTDGLIENSLEIKRGTSSKKTIRIQQIAKYTGTLSNNNAGLTLKLKYPQNKIDWSL
EMSHENTENSLFNKMTLNYAPGRQLSTAIDVAIQPQTKLDVQVNYPGRETRLSGNYRNVG
SDEYKGNLLAQWSKEQKIEASGTFRLGAERRQYNPSFEIEILIPNRRPVTVSGALKAAKG
YYTIKGASQCSVGRHELNAAYRFVNQYNHDASIKIETPRDNYAANGVFKIESNKVVANAN
VKLGRVREVSIESELTSSRDVKMVKFDCKWDAAKDPSRRATINGEFRRVSGGYQGNFVVK
CPKQDIRGTVSTTTQGRLDGGLLRISSTGEIEWQPRKKATYVANIDWNPETSRRVLKADM
TITTPFQKADILGLTLTHRYDGREWASEGRMTLPQRRILSIASDGDVLIDRSRRIIKGNV
KVNTPAGKEFSLMATHSLSQFEINNMVKFHWDEGKAVAAEVSGAYGRGMLRGKAEVITPI
IGYERVGASFDHAHGPAYVRCQASAQWKRGQEVSFSLNGQHTSTGLRKVCEADIRITTPI
RGLELMSSKMTYNNDGKKLSADIEASNGYNKITTGLSASKKRQRGGDASSEMRLYFNSPV
QGYENLEVTGTYSVHQEKVMVSADAKLPYSKTASLRSQGRVASMNNFDSSITIQLPIRNY
EQLKMEVAHNIHSRSLKTTGLIAFGRNEYTAVLNGDIMYSQGSSDITGMLTITTPIRAYE
AISMNLRQTRRGGNLDCRLGVAIGQSSLTVVHDMKIGDNGNFEQNLEIITPFKTMSSLTV
RNTNQLQNGRLSHSTEIEWQRRNKVALNIDASSSSTRNDYNMDANVRLITPWRALSNANI
KASNYYNHQEVKSKVSTEWNNGENIALEWGFQNDRYRSLESKLQLTSSIKAIEMVTVNAK
YDVSSEQKTGELSFQWDPRPEKMVTLTGSASLKEGASDIDISCTTPISGYERVQLLCNYK
NEYNAKSASITLQSQWKKIALVGNLQNSRTGSTAELSLATPIRGLELQKISGEYSTEFGK
LMSKVDAEWSGKMMSLESELEKADRRASAKVTFKTPFEGMRNMEMNLNGNFESNTKVLSS
MLQCDAKTIELSATIDTTDRTAKFQLRSPFENLEEIELNAGIEDRGRTRQVTASISWAPG
KMINIESAAAPESIKLTLTTPFRGYRRLSGSGAMENRGGSSTFNAVFEKENKKIALSTSN
SYNRDLEGTIKLTTPFRSYEELSMAYYITYEGIKNMKASFSLRTPIEGAQTIDIKAETSI
AADQYRGLISLEAPNSRYELNGQMTYQGIRLVDGQMSLITPHQQLRTANLKVNLRTGGLR
FINGGIALTTPGGEHALSLDIKNSGPFEGSFEVNCPLLPQGKATVSYMVNVPNKDFADFR
ITAGFGEESHKVLGSYENKRSIYRSQISLDSPMLKEGPASFKLELSSLRPREIKAVLSFG
FERNMNTINIDAGANGGVLKCKLSAESILLPSRSLTAEGIVTTTRQGADISMIFEDSKTS
HRLNANWKQVAGTADGQLRIESPLLSFNSLTGTITYSNTPNLMEGTLVMETPKKTIKCFG
ALRGSSLRNFEGNLNLETPFESLRFANIDINFNNEYDRVMDGSLSIKTSVPSLISDANIS
GQIRNNPGSFESSLKGRLPIGMLSNFEQTFVCKYNNDLTSISPRLTVTLPNFKVVDYAEI
NYARGGFQLTAGHEWGADQKIEALIAIKKPAGQFKVDASLSTPFRNMETFEVSMMCARES
DKRVFRASYKAPSRNIYEIQHSNTYYNPLNFNVENSVTTPIRGFELMSLRVRQQSSRSRL
VSNLEGNLWRRRMIFNLDHDKNANKGNVQITSPYQEARSVKLTYDINKYKVDGELTVNDR
RMIKIAGNSEYVHNLRSHKCDAVVDIPAIRTALEAHYKPVSSGLELASKFSSSRRTITFD
TLFQKAPENFVHQASLKWGQGKGEEFSYDIRATHSRRRDLKNTDMSCKEIVMRLDGSISS
DELHGKTELEYSRDQNHNLVLEGRCKRRGPSHVTVELTARQPVSSMDIRTMAELKDARDE
VSALISVNYMNRNRQMRVHELKASIFKLRKAIDILLRSGRDQSQLKGEMYNRDQEFGMEL
EHQVNLLPPTKTHLRINKRHSNVEIAYNSPDDYSAIMSASASPDKRELKLSHRTLGRSVS
DLLLKMALKEKRYLGSEVSWRPELTKEAREYASQRYNTLCNEASRLWSDFASETEQEFRA
KRFIMGQSLQSQIRPVLEDIESDLGVLSSEISQAADKLETMYYQDEFYMKTVLSTMSAAA
WEARCAALKIGRLVLVATKGAVDVCTNVMTAAGEKITIAADRVAFACRRSFIFAEKVLSV
VIDRTSLAAARATEWAMYKVEGVASKLMQKTISLLERYGPSPSIVRDAYNKAVKMVSVYT
APIIESIAKNPLVQGLYRYVERVCATLNAFSMESIKRRSYYAYNTVANNVIEVTDNILVH
PHVKYVKNMAQNIARKARDISEQLGMPDMAAGVIEMGKQQIQDGLLNGLSDAVREYSNLR
SGMRVEYAPERGVMSAELRLPSSKANLAEALDITSYPEYDKIMGLKDNYYGVGANSVWDA
YYKYSHYGNPRHWMPPFKARALMAGPQHYRTFDGFHFEFAGECSYLLAKDFLNDQFAVII
NYVRDGHRVVKKSITVNSDGQRFDISSDYKVTQGGNKVELPQDTGATTIRREGHVVIVEN
NSGLTVRCNLYYDQCVTEITGDHFGKTGGLLGTYDYEDKLDLMTPDRRITDDPTVFANEW
EVGHGRCRSQQNMAQPMVTDSRATSVCKNLFEEEKSVFRSCFKMVDPKPYLKMCLHDMSS
ASYDQMEKATCVSAAAYREECNEFGVELEMPRTCVRCEKPDGSEILSGEITTVTEDESVN
TADVIFVVERKLCNKNVMPNLIRLAQGLDERYASKGFSNMRYAVVGFGGDGVAELPHIVT
ADGQVFNSIRSIISAFSSLTVGNGNSDVFSALKYAAKLPTRMGSSQVMMLVKCTTCTPGE
DPSVYTDIYRMLIDRGMHLHILDDDDFAVRTAAKPSKSKRIFGVDHRLAYTAKDLKEMHG
DADIHSQIRLPKDFCVPLALETNGTLFSSLKMFEKRNVNKKFIDVMARRVALSEAPDCQI
CECVSAEDGVGQSLCNRCVSPTLGPVRSPDFSPSMYDEVVERKGYKRPKTKKLRHRK
Download sequence
Identical sequences B7Q381
6945.ISCW009032-PA XP_002411179.1.51680 ISCW009032-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]