SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ISCW016768-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW016768-PA
Domain Number 1 Region: 719-738,863-1086
Classification Level Classification E-value
Superfamily HAD-like 1.22e-53
Family Meta-cation ATPase, catalytic domain P 0.00018
Further Details:      
 
Domain Number 2 Region: 513-598
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.62e-24
Family Calcium ATPase, transduction domain A 0.003
Further Details:      
 
Domain Number 3 Region: 262-330
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 4.84e-18
Family HMA, heavy metal-associated domain 0.00072
Further Details:      
 
Domain Number 4 Region: 181-255
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 8.64e-18
Family HMA, heavy metal-associated domain 0.00087
Further Details:      
 
Domain Number 5 Region: 5-73
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 3.01e-17
Family HMA, heavy metal-associated domain 0.00072
Further Details:      
 
Domain Number 6 Region: 84-148
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 6.02e-17
Family HMA, heavy metal-associated domain 0.00067
Further Details:      
 
Domain Number 7 Region: 439-496,599-713
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000196
Family Calcium ATPase, transmembrane domain M 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW016768-PA
Sequence length 1091
Comment copper-transporting ATPase 1, putative|DS660824:135072:167821:-1|gene:ISCW016768
Sequence
MGSRAIATFEVEGMTCQSCANTIGKALSELPGVCDYKVDHKGNSAAVTYDTAATCPESIR
GCIEDVGFGARHRAAPRIDFAIYEGMTCSSCVRNIEAHVGQLPGVKGVRVSLEAECARFV
FDGGLVSAEQLAEAVEDMGFECSVLSASPVDADVPEVGFAERKEGSGDHVSVNNERLGNF
DETEKCFLRVTGMTCSSCVSAIERQLISVKGVKFALVALLPQKAEVKYNPALVQPSQLVE
LVNSMGFNASILNDHKTVHGEAEFLIRGMTCSSCVHAIESNVSKLPGVESASVSLGTQKG
RFLFDPERTGPRQILDKIHSLGFEASPFTDHKIDASYLCQKEEVKKWRNSFLFSLVFGVP
SMLLMMYYMAERMITKRHNQCCMLPGLSSENFFLFLLATPVQFIGGRYFYVQAWKALSHR
VANMDVLIMLATNVSYFYSVIIVIYFIVDGADHSPKTFFETPPMLLMFISLGRWLEHIAK
GKTSAALAKLISLQATEAALVQVDGEFNIISEKYINVELVQRGDIMKVIPGEKIPVDGRV
CFGSSMVDEALITGESLPVPKKVGSQVIGGSINTNGVLLVVATHVGKDTTLAQIVKLVEE
AQTSKAPIQQLADRLAGYFVPGVVLVSLLTLGIWVLVGFHNVDNITAFFPRQDHHSSDSE
LICQFAFQCALTVLSIACPCSLGLATPTAVMVGTGVGASLGILIKGGEPLELLHKVKCIV
FDKTGTITNGVPVVTRIALFVENNICSLSKMLALVGTAEANSEHPIGVAITKFVRKILET
ETLGKCEDFAAVPGCGLRCRISGVDAVLQRTKDTESLVTKGLRPPSTGYRGTGSGTEEVF
IDRCATQPMFAGDRRSSGNSVVLIGNREWMHRNGVVVNSQVDAIMEQHEEKGQTAVLCTI
DGILVCMLAVADTVKPEARLTVYTLKKMGHEVILLTGDNKKTAAAVAREVGIKHVYSEVL
PSHKVMKIQQLQEQGRRVAMVGDGVNDSPALAQADIGIAIANGTDVAVEAADVVLVRNDL
LDVVGAIALSKATVQKIHRNFFFATIYNLVGIPLAAGVFMPFGIVLKPWMGSAAMAMSSV
SVVCSSLLLRR
Download sequence
Identical sequences B7P8W7
XP_002403289.1.51680 6945.ISCW016768-PA ISCW016768-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]