SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ISCW019802-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW019802-PA
Domain Number 1 Region: 968-1077
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-25
Family PDZ domain 0.00015
Further Details:      
 
Domain Number 2 Region: 238-337
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.91e-19
Family Ras-binding domain, RBD 0.00017
Further Details:      
 
Domain Number 3 Region: 388-489
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.24e-18
Family FHA domain 0.00012
Further Details:      
 
Domain Number 4 Region: 42-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.31e-18
Family Ras-binding domain, RBD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW019802-PA
Sequence length 1813
Comment afadin, putative|DS785108:309158:381179:1|gene:ISCW019802
Sequence
MASEREVRTVERINLRNIINQWNANRLDLFELSEPNEDLEFHGVMRFYFQDADQKVVTKC
IRVSSTASVHDVVCTLIEKFRPDIRMLSIPDYTDYALYEIHENGEERKLGGEEKPLLVQL
NWHKDDREGRFLFRRMDEKSRLPSLQGESLRFGRKLSKREKRDKKKRDKKEAVREGEGRG
GASAAGRDGIAEKLYTELPETSFTRSISNPEAVMRRRRQQKLERKLQQFRQEGSPEAGGT
LRIFGESLNRDVPYKTLLLSTTDTASHVVKEILDKYGLDQEEPLHYCLVQPGGGMGPLGS
IQGVKEYILDDDDCPLAIERQHNRLKGTLSFHIRRRPADYQPRKRKKKPSSHGGVELPGP
TSPQGLPQGNPQGVVPQGGFRCGSLYDRLPFLLAVHPDGGQPGPRHRILLNMTEVGSAPS
GTQCLQLQGPGIHPRHCVIAHTEGVVTVTPSHQEAEIYLDGCRVYDTTILQHGALVRFGR
HHTFRFLEPELAHRPHQVRLPCRWRHLHGVVGGTSVDGGRPRLKGPGACSRRLVGEEDPA
SAYEGPPDAGETASVHSHRTEDAGPPPGGDVRRGDPILPAVLEFWEEHEAVFLEAVVGQL
DWAGVQFKLAPTYTLYMACRYRASTHFRPEISPAERAQRLTALANHLGALVRSTVERRSS
DPGPLALWLANASELLHFLRQDRHLSAYTLDAQDLLTEAVQLAFRHLVAAQRRELAQALP
RAFLEARDPGSDSAVARRPPAGEVLGVLAGSMSLLRRCRVNAALTIQLFSWLFHHVNMWL
FNSLLAGSSPCNRQTGSLLKRRLAHLVAWAEKQGLELAADCHLARIIQASPPLGTRGAAL
VREVASISSACFKLNSLQLRHLLECYEPGPDEAPVSPSLVEGVVRVAQQTADQQAHAEGR
PLRLQEDPDLQLPFLLPEDGYSCDIVRGVPPGLQDIARPLAGLCRLTLQPTSLGYWTIYM
SDQDGPPRPSPPEVRGDGRGGPRPPEGPQVATITLHKSSNGMGLSIVAARGTNQDRLGIY
IKSVVKGGAADQDGRLQAGDQLLRVDGHSLVGITQEKAADLMTQTGQVVNLEVAKQGAIH
HGLAALLCQPSPLMHRGRLGGRSLGPLGIALCATNFLRSQSVRSTARAHSFEGIPSPVRG
TAAASALPPDPSPSPMLSGEANRGSSAATTSSSASTPDLCALRNACRRHPLPVAAAAAAP
WRCSGRRRRRWTGPVAGGLPPLPRWPTADRLPSSCLLVGNRLQNGCSPIAKQLPTDCRAS
AVLLRRVPAYHSSQPQLARGSPGGPRGDQASRPLSTLVSPREQEQYASGMGFPAQRPAGL
SPKRNPGRPPEGGTHPPQRPPMPAEMRWVHSDATPAPRWASLSKCGTSFLGMSLAPTPSP
LFEQHQSCEADGGSMHRAQPSLHQRDLIRQEAKMEEMKEEVRRREEREQHAHWAASQRGP
PVADWAPPQQTQQCPSTFLQRTEAVLSLLGRPLYVPFSIDLRFSVPVRAPRRETGAKVLS
PSPWEREEKEMRRLQRLEGVRLARDEEVRELECLPERSARQEERLRTLRLEQEFERRAQE
AVQAHGDEEEEDDEVRNSLPSFGRPRLDRRLHPAPIGGWGRIANGCPKPSPPPQEQEGRL
RQLRLEESGKKQELEAQRRAEERLLREAQRRRQQHEQPPPPVARGVEEEPPPLPACPPPP
AEGAPRPPRQTGPKKVSFHETPTELVDANGNPEEEEEEEEEMQAGSSAYLVGNTPGVIGA
QEVYRDPRQRIERQRALEQPARPPGPEKLTFREKMRMFARETGEDHTPRDKMKISRAQRE
IETSLNGVATPHR
Download sequence
Identical sequences B7PTE1
6945.ISCW019802-PA ISCW019802-PA XP_002404205.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]