SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ISCW021706-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW021706-PA
Domain Number 1 Region: 3-132
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000000000157
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW021706-PA
Sequence length 153
Comment hypothetical protein|DS853155:605937:607255:1|gene:ISCW021706
Sequence
KYDMGSMSLLSVIRSEDSLLPNSVYLDAKHYIAGYAYDTFALSYEGWGVDKLLNALVGPQ
PGSTRNLWNVLSRRRFTRDTSTQERKNIEDALPIADRNYDPLYGRLSLSLFGNAVNILEF
DESLLASLQGHADPAETIRKLFGREVHFKNFFL
Download sequence
Identical sequences B7Q404
ISCW021706-PA 6945.ISCW021706-PA XP_002411433.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]