SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|MicpuN2|100629|fgenesh2_pg.C_Chr_05000322 from Micromonas sp. RCC299

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|MicpuN2|100629|fgenesh2_pg.C_Chr_05000322
Domain Number 1 Region: 370-561
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.96e-32
Family cAMP-binding domain 0.00058
Further Details:      
 
Domain Number 2 Region: 108-366
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.26e-31
Family Voltage-gated potassium channels 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|MicpuN2|100629|fgenesh2_pg.C_Chr_05000322
Sequence length 588
Sequence
MEYSRARERYEMNQWGNKDSKDVKIGVRTVIDEDDPALKLSDDASMNQALSRWNQVRNLL
SSKASLTLLRSDSSIKNEAALYGGTIDSDSMKDPHGEPEPVGRWWYVNPDGRFRSSWDIF
QVAVLCYLACATPYRVAFDAPAYGPAFWWEFFVDLYFIADVFLNFVTGYWEELETTSVLV
SEPWPIAMNYLRTWFPIDAVACAPVDLVTRALEGTLRCSFEPDGCSAAEKYDANVDANAL
KLFKLLRIFRLVKLLRLFRVSRLLHRYQNQLIYYHSFISVARVNGLVILIAHWMGCIYGM
NYEQNLDDNSGNRWLQSIYWAVQSITSVGYGDMPADNEITMLIAIFTMLMGVVLCSWIMT
NVLAAMNPDSSSKRFHERLQYVIAYLKNNQLPQGVAKRVITFYRWQNMNQFDEKSVLSDL
PPSLRKDIFDNLYTDALVGVPIFKNMSNQFITEVCLRMSPISFPQFHSVYGQGELGYDMY
FITKGSVAVLLNEMPHNPSTDELQTMVDSCIELGRGSFFGEPAVLGFASRLETIVCTRSC
TMMTLNQDHMDELCQLSYEFKAELTGSEGGLHVVPAGFRCRRGGDHSG
Download sequence
Identical sequences C1E6Q5
jgi|MicpuN2|100629|fgenesh2_pg.C_Chr_05000322 XP_002502217.1.63511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]