SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|MicpuN2|86011|e_gw2.10.184.1 from Micromonas sp. RCC299

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|MicpuN2|86011|e_gw2.10.184.1
Domain Number 1 Region: 12-324
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.13e-66
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|MicpuN2|86011|e_gw2.10.184.1
Sequence length 336
Sequence
MSDAEIAEAGALSDEEISEAYTMMQLCRDFENECNQAYMAGKIRGFMHLDNGQESIPALL
GNAIRKTDLKHSYYRDHCHALACGVDAGAVMAELFGRDGGTCRGTGGSMHIYDMETNFQG
GWALVAEQLPYAVGAARSIALDKHLGTGEAEDRIAVVFVGEGGAQNGRMAECLNAAAKEN
LPILFVVIDNGRAINTFTKDVATNQEVFNQGKHYGIPGVLADGQNVQDTMRIGRAAIQHV
RTKGPAILQVHTFRFNGHSPADPEHERNRKDEKRWARAACDPIKIFEESADAARVDLAAC
TAKAREEVRKALEFANASPPPPKDLAAQLEYPDPTG
Download sequence
Identical sequences jgi|MicpuN2|86011|e_gw2.10.184.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]