SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|MicpuN2|88562|e_gw2.15.43.1 from Micromonas sp. RCC299

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|MicpuN2|88562|e_gw2.15.43.1
Domain Number 1 Region: 389-593
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.29e-63
Family Pyruvate oxidase and decarboxylase PP module 0.000000157
Further Details:      
 
Domain Number 2 Region: 21-195
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.01e-58
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000000977
Further Details:      
 
Domain Number 3 Region: 212-377
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.37e-56
Family Pyruvate oxidase and decarboxylase, middle domain 0.00000448
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|MicpuN2|88562|e_gw2.15.43.1
Sequence length 609
Sequence
MQDLASQRPVANFQSRFGDDEPRKGADILVEALEREGVDCVFAYPGGASMEIHQSLTKSK
TGVRNVLCRHEQGEVFAAEGYAKCTGKVGVCIATSGPGATNLVTGLADALLDSVPMVAIT
GQVPRRMIGTDAFQETPTVEITRQITKHNYLVMDVNDIPRIVREAFFLASSGRPGPVLID
IPKDVQQQMSVPYWGPKVSLNGYLSRLPSPPSHPQMERVLDMIKDAKRPVVYAGGGCLDA
APELKEFIESTGIPITNTLMGLGCYPASDELCLDMLGMHGAVYANYAVDSADLLLAFGVR
FDDRVTGKLEAFAARASIVHIDIDPAEIGKNKEAHCPVFSNIKPALRTLNSIIRADKPEL
DFSEWRADIAKQRAKFPFAYTETDDYIVPQHAVELLCKMTEGKAIISTGVGQHQMWAAQH
YKFDEPRNWLTSGGLGSMGFGLPAAIGAAAARPDAVVIDIDGDGSFVMNIQELATLHAEN
LPVKMFVLNNQHLGMVVQWEDRFYGANRGHTYLGSPDKDYAVTQDEADIFPDFVKICEGF
RVPAERVVRKADLKDAIQRMLDHDGPYLLDVMFPHQEHVLPMVPGGGTFKDTITTGDGRT
PETKDMKTL
Download sequence
Identical sequences C1EI66
XP_002506548.1.63511 jgi|MicpuN2|88562|e_gw2.15.43.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]