SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPAG_02052.1 from Candida parapsilosis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPAG_02052.1
Domain Number 1 Region: 54-413,443-525
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.19e-114
Family Pyridoxal-dependent decarboxylase 0.000000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPAG_02052.1
Sequence length 587
Comment | CPAG_02052 | Candida parapsilosis CPAG_02052 (588 aa)
Sequence
MFKPNRFTSLYPRFVRHFTKYPPTMVLSKHIDAYDLEYELLRDSHKVKLTSDEFNDEYNS
SKLVPRYVIPEKSASEGDIYKYLNQELALDGIPTLNLASFVNTYVDEHQKKLAVENLTKN
LADNDEYPSLIDIQNRCVTMLSNLWHAPHKTDPKTGAKIVNSLGTATTGSSEAIMLAGLA
LKKRWQEKRRAEGKSTEKPNILMATCAQVALEKFAVYFDVENRLIPINPESGHLIDTTKI
KENVDENTIGIFVIMGSTFTGAFEPVVEISKILDEVEKEKGLNIRIHVDGASGGFVAPFA
FPHLKWDFAVDRVDSINTSGHKFGMTSVGLGWVIWKDESLLPKELRFSLDYLGGVEETFG
LNFSRPGFPVILQYYNFLSFGKEGYTKIFDGCLSNARLLSNYLDKSTYFDVVSVIHKSAT
PEEQKKLYTREVKHLPSLTVNESFQPGLPVVAFRFSKEVRDKYPEIPQELFSTLLRKRGF
IVPNYHLPPDETNVEILRVVVRNSLSLALLEKLIEDCTDIIELLVKSAESVREILSNKEE
ASEHNTSTIHDLLLSIASGGLQPIRQKQHERDGHKAGVAKKSYRGTC
Download sequence
Identical sequences CPAG_02052.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]