SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPAG_02348.1 from Candida parapsilosis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPAG_02348.1
Domain Number 1 Region: 125-540
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.32e-106
Family Pyridoxal-dependent decarboxylase 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPAG_02348.1
Sequence length 584
Comment | CPAG_02348 | Candida parapsilosis CPAG_02348 (585 aa)
Sequence
MPPVEISFDWPKSIEEIPVVASTIYHQLKLLILVQYFSNNDRVWGSVHLARDIVFVLFIY
TAVVKILHAIWSYGITGIVKKIYYSVFSSISQKFMSLPFIKSKIDKELNETVKKIEKQVI
QNDESLMQFTELPNKGLDDSVVTEELVKLQGLKHSDWVNGRVSGAVYHGGDDLLKLQSEA
YHKYSVANQLHPDVFPGVRKMEAEVVAMVLDIFNAPEGACGCTTSGGTESLLLTGLAARE
YGRKYKGITAPEVIAPITIHAGIEKACYYFGMKLHKVDLDPKTYKVDIGKVKRLINKNTV
LLCGSAPNYPHGIIDDIEALSKLAVKHDIPLHVDACLGSFIVTFLESSKVHGSKELPLFD
FRVPGVTSISCDTHKYGFAPKGSSIIMYRSPKMRECQYYISSDWTGGMYGSPTLAGSRPG
ALMVGCWATLVHIGKDGYKKNCFDIVSATMKLRKAIETNPVLSKYLEVIGDPLASVISFK
VKSSKSNNLSIYELGDLLGKKGWHFATLQHPAALHFALTRLTVPVIDELIADLVSSTEEA
VAYVKEHGKTTGDTAAMYGVAGSIHTSGLADKLIAAFLDSMYKT
Download sequence
Identical sequences G8BAR6
CPAG_02348.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]